(data stored in ACNUC7421 zone)

EMBL: CP000462.GOR

CP000462.GOR         Location/Qualifiers
FT   CDS_pept        complement(20671..22020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="AHA_0019"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01421"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37668"
FT                   /db_xref="GOA:A0KR16"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR16"
FT                   /protein_id="ABK37668.1"
FT                   /translation="MAQHFDYIAIGGGSGGIASANRAAMYGKKVALIEAKELGGTCVNV
FT                   GCVPKKAMWYAGQIADALKYGADYGFDTTLNHFNWAKLVESRQAYIGRIHQSYQNVLGK
FT                   NQITVIKGFARFVSSNTIEVNGEQYSADHILIATGGRPEVPAIPGAELGIDSDGFFELQ
FT                   SQPKRVAVVGAGYIAVEIAGVMQALGSETHLVVRKHAPLRNFDPMIHETLVEIMAQEGP
FT                   KLHTHAIPKAVVKNADESLTLQLEDGRHLTVDCLIWAIGRVPATDNLNLAAAGIELDEQ
FT                   GFIPTDKFQNTAVANVYAVGDNTGRIQLTPVAVAAGRRLSERLFNNKPGEHLNYDLVPT
FT                   VVFSHPPIGTIGLTEPEAIAEYGEGQVKVYRSQFTAMYSALTQHRQPTRMKLVCVGPEE
FT                   KVVGLHGIGFAMDEILQGFGVAMKMGATKADFDNCVAIHPTSAEEFVTMR"
     atggcacagc attttgacta tatcgccatc ggcggcggca gcggcggcat cgcctcggcc        60
     aaccgggctg ccatgtacgg taagaaagtt gccctgattg aagccaaaga gttgggtgga       120
     acctgcgtca acgtcggctg cgtgccgaag aaggccatgt ggtatgccgg ccagatcgcc       180
     gatgccctga aatatggcgc cgactacggc ttcgacacca ccctcaacca cttcaactgg       240
     gccaagctgg tcgagtcccg ccaggcctac atcggccgca ttcatcagtc ctaccagaac       300
     gtgctgggca agaaccagat caccgtcatc aagggcttcg cccgcttcgt cagcagcaac       360
     accatcgaag tgaatggcga gcagtacagc gccgatcaca tcctgatcgc cactggcggc       420
     cgccctgaag tgccggccat cccgggtgcc gagctgggca tcgactccga cggcttcttc       480
     gagctgcaga gccagcccaa gcgggttgcc gtggtcgggg ccggctatat cgcggtggag       540
     atcgccgggg tgatgcaggc gctcggctca gaaacccacc tggtggtgcg caaacatgcg       600
     ccgctgcgca acttcgaccc catgatccac gagactctgg tcgaaatcat ggcgcaggaa       660
     gggcccaagc tgcacaccca cgccattccg aaagccgtgg tcaagaacgc cgatgagagc       720
     ctgaccctgc agctggaaga tggtcgccac ctcaccgtcg actgcctgat ctgggccatc       780
     ggccgcgtcc cggccaccga caacctcaat ctggccgccg ccggcatcga gttggacgag       840
     cagggcttta tcccgaccga caagttccag aacaccgccg tcgccaacgt ctatgccgtc       900
     ggtgacaaca ccggccgcat ccagctcacc ccggtggctg ttgcggcggg tcgccgcctc       960
     tcggagcggt tgttcaacaa caagccgggc gaacacctca actacgatct ggtgccaacc      1020
     gtggtgttca gccacccacc catcggcacc atcggcctga ccgagccgga agccatcgcc      1080
     gaatacggtg aaggtcaggt caaggtctac cgcagccagt tcaccgctat gtattcggcg      1140
     ctgacccagc atcgccagcc cacccggatg aagctggtct gcgtcgggcc ggaagagaag      1200
     gtggtcggcc tgcacggcat cggcttcgcc atggacgaga tcctgcaagg cttcggcgtc      1260
     gccatgaaga tgggcgccac caaggcggac ttcgacaact gtgtcgccat ccacccgacc      1320
     agcgcggaag agttcgtgac catgcgataa                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page