(data stored in ACNUC7421 zone)

EMBL: CP000462.GREB

CP000462.GREB        Location/Qualifiers
FT   CDS_pept        complement(331424..331897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="AHA_0304"
FT                   /product="transcription elongation factor GreB"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01461"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39100"
FT                   /db_xref="GOA:A0KF16"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF16"
FT                   /protein_id="ABK39100.1"
FT                   /translation="MKTKLITREGYNKLKQELDFLWREERPETTRKVAWAASLGDRSEN
FT                   ADYQYNKKRLREIDRRVRYLRKCLEELGIVDYSPAQEGKVFFGAWVEVENEEGETKRFR
FT                   IVGYDEIFERKDYISIDSPMARALLKKEVGDEAIVRTPVGDACWYINEISYPK"
     atgaagacca agctgatcac ccgtgaaggc tacaacaagc tcaagcagga gctcgatttc        60
     ctctggcgcg aggagcgccc cgagaccacc cgcaaagtgg cctgggcggc cagcctcggt       120
     gatcgcagcg agaatgccga ctaccaatac aacaagaagc ggctgcgaga gatcgaccgg       180
     cgggtccgtt atctgcgcaa gtgcctcgag gagctgggga tcgtcgacta ctcccccgcc       240
     caggagggca aggtcttttt cggtgcctgg gtcgaggtgg aaaacgagga gggagagacc       300
     aagcgctttc gcatcgtcgg ctatgacgag atcttcgagc gcaaggatta catctccatc       360
     gactccccca tggcccgcgc cctgctcaag aaagaggtag gcgacgaggc catagtgcgt       420
     acgccagtcg gtgacgcctg ctggtacatc aatgagatca gctatcccaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page