(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPD

CP000462.GSPD        Location/Qualifiers
FT   CDS_pept        603731..605764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="AHA_0569"
FT                   /product="general secretion pathway protein D"
FT                   /note="identified by similarity to SP:P45758; match to
FT                   protein family HMM PF00263; match to protein family HMM
FT                   PF03958; match to protein family HMM TIGR02517"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38515"
FT                   /db_xref="GOA:A0KFS6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS6"
FT                   /protein_id="ABK38515.1"
FT                   /translation="MINKGKGWRLATVAAALMMAGSAWATEYSASFKNADIEEFINTVG
FT                   KNLNKTIIIEPSVRGKINVRSYDLLNEDQYYQFFLSVLDVYGFAVVPMDNGVLKVVRSK
FT                   DAKTSAIPVVDESNPGSGDEMVTRVVPVRNVSVRELAPLLRQLNDNAGGGNVVHYDPSN
FT                   VLLITGRAAVVNRLVEVVRRVDKAGDQEVDIVKLKYASAGEMVRLVTNLNKDGNNQGGN
FT                   TSLLLAPKVVADERTNSVVVSGEPKARARIIQMVHQLDRDLQSQGNTRVFYLKYGKAKD
FT                   LVEVLKGVSSSIEADKKGGAATTTGGGGASIGGGKLAISADETTNALVITAQPDVMAEL
FT                   EQVVAKLDIRRAQVLVEAIIVEIADGDGLNLGVQWANTNGGGTQFTDTNLPIGSVAIAA
FT                   KDYQKNGTTTGLAALAKDFNGMAAGFYKGNWAALVTALSTNTKNDILSTPSIVTMDNKE
FT                   ASFNVGQEVPVQSGSQSSTTSDQVFNTIERKTVGTKLVVTPQINEGDSVLLNIEQEVSS
FT                   VAQTQAPGTSTLGPTFDTRTIKNAVLVKSGETVVLGGLMDEKTQEKVSKVPLLGDIPVL
FT                   GYLFRSTSNSTSKRNLMVFIRPTILRDADVYSGISSNKYSQFRSEQQEAAAQEGYLTSP
FT                   KRQVLPQYGQGVTMSPEVQKQLQQTQQAPQASGGSQPFVGNK"
     atgataaata aagggaaggg ctggcgtctg gccaccgtgg ctgcggcgct gatgatggca        60
     ggttctgcct gggccaccga atattccgcc agcttcaaga atgccgacat cgaagagttc       120
     atcaacacgg tcggcaagaa cctgaacaag accatcatca tcgagccttc ggtgcgcggc       180
     aagatcaacg tccgcagcta tgacctgctc aacgaagacc agtactacca gttcttcctg       240
     agcgtgctcg atgtctatgg cttcgccgtg gtcccgatgg acaacggcgt gctcaaggtg       300
     gtgcgctcca aggatgccaa gacctccgcc atcccggtgg tggacgagag caaccccggc       360
     agtggcgacg agatggtgac ccgggtggta ccggtgcgca acgtttcggt gcgcgaactg       420
     gcgccgctgc tgcgccagct caacgacaac gccggcggcg gcaacgtggt ccattacgac       480
     ccctccaacg tgctgctgat caccggccgc gccgccgtgg tcaatcggct ggtggaagtg       540
     gtgcgccggg tcgacaaggc gggcgaccag gaagtggaca tcgtcaagct caagtacgcc       600
     tctgccggcg agatggtgcg gctggtgacc aacctcaaca aggatggcaa caaccagggc       660
     ggcaacacct ccctgctgct ggcccccaag gtggtggccg acgagcgcac caactcggtg       720
     gtggtgagcg gcgagcccaa ggcgcgcgcc cgcatcatcc agatggtgca ccagctcgac       780
     cgtgacctgc agagccaggg caacacccgg gtcttctatc tgaaatacgg caaggccaag       840
     gatctggtgg aggtgctcaa gggcgtcagc tccagcatcg aggcggacaa gaagggcggc       900
     gcggccacca ccacgggcgg tggcggtgcc agcatcggcg gcggcaagct ggccatctcc       960
     gccgacgaga ccaccaatgc gctggtgatc accgcccagc cggacgtgat ggccgagctg      1020
     gagcaggtgg tcgccaagct cgacatccgc cgtgcccagg tactggtgga ggcgatcatc      1080
     gtcgagatcg ccgatggcga cggtctcaac ctcggggtgc agtgggccaa taccaatgga      1140
     ggcggtaccc agtttactga caccaacctg cccatcggtt cggtggccat cgcggccaag      1200
     gattatcaga agaacggtac caccacaggt ttggctgcct tggccaagga tttcaacggc      1260
     atggcggccg gcttctacaa gggcaactgg gccgcgctgg tcaccgcgct ctccaccaac      1320
     accaagaacg atattctctc cacgccgagt atcgtcacca tggacaacaa ggaagcctcc      1380
     ttcaacgtcg gccaggaagt gccggtgcag agcggttccc agagctccac caccagcgat      1440
     caggtgttca acaccatcga gcgcaagacg gtgggtacca agttggtggt gacgccgcag      1500
     atcaacgaag gggattccgt gctgctcaac atcgagcagg aggtctccag cgtggcgcag      1560
     acccaggcac ccggtaccag cacgctgggc ccgaccttcg atacccgtac catcaagaac      1620
     gctgtgctgg tgaagagtgg cgagaccgtg gtgctgggtg gtttgatgga cgagaagacc      1680
     caggagaagg tctccaaggt accgctgctc ggcgacatcc cggtgctggg ttatctgttc      1740
     cgctcgacct ccaactcgac ctccaagcgc aatctgatgg tctttatccg accgaccatt      1800
     ttgcgtgatg ccgatgtcta cagcggtatc tccagcaaca agtactccca gttccgctcc      1860
     gagcagcagg aggcggcggc gcaggagggc tatctcacct cgcccaagcg ccaggtgctg      1920
     ccccagtacg gccagggcgt gaccatgtcg cccgaggtgc agaagcagct ccagcagaca      1980
     cagcaggccc cgcaggcgag cggcgggtcc cagccattcg tgggtaacaa gtaa            2034
//

If you have problems or comments...

PBIL Back to PBIL home page