(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPE

CP000462.GSPE        Location/Qualifiers
FT   CDS_pept        605764..607269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="AHA_0570"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by similarity to SP:P31741; match to
FT                   protein family HMM PF00437; match to protein family HMM
FT                   TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37044"
FT                   /db_xref="GOA:A0KFS7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS7"
FT                   /protein_id="ABK37044.1"
FT                   /translation="MAAYQLDGVDMPAALPELPFAFARNFGVILTERQGAPVLLCRQGV
FT                   TPQTLLEVRRVAGCAFTVEQMDREAFEELLMAHYQRDSSEARQLMEDLGNEMDFFALAE
FT                   ELPQSEDLLDADDDAPIIRLINAMLSEAIKEEASDIHIETFERALVIRFRIDGVLREIL
FT                   RPHRKLASLLVSRIKVMSRMDIAEKRVPQDGRISLRIGGRAVDVRVSTMPSSYGERVVL
FT                   RLLDKNNVRLELKQLGMTLANRNIISELIRKPHGIILVTGPTGSGKSTTLYAALSEINS
FT                   RDRNILTVEDPIEYDLEGVGQTQVNSKVDMTFARGLRAILRQDPDVVMVGEIRDLETAQ
FT                   IAVQASLTGHLVMSTLHTNTAIGAITRMRDMGIEPFLLSSSLLAVLAQRLVRTLCPDCR
FT                   APRAITEQERIAMGIELAPDQQVWRPVGCEQCNHTGYRGRTGIHELVVIDEAVREAIHS
FT                   ASGELAIERLIRGHTPSIRRDGIDKVLKGQTSLEEVLRVTRED"
     atggcggcat accagctgga tggcgtcgac atgccggcag ccctgcccga gctgccgttt        60
     gccttcgccc gcaacttcgg cgtgatcctg accgagcggc agggggcacc tgtgctgctc       120
     tgccgccagg gcgtgacgcc gcaaaccctg ctggaagtac ggcgggtagc gggctgtgcc       180
     ttcacggtgg agcagatgga ccgcgaggcc ttcgaagagc tgctgatggc ccactaccag       240
     cgcgactcct ccgaggcgcg ccagctgatg gaggatctcg gcaacgagat ggacttcttc       300
     gcgctggccg aagagctacc tcagagtgaa gatctgctgg atgccgacga cgacgccccc       360
     atcatccgtc tcatcaacgc catgttgagc gaggcgataa aagaagaggc gtccgacatc       420
     cacatcgaga ccttcgagcg cgccctggtg atccggtttc gcatcgatgg ggtgctgcgg       480
     gagatcctgc gtccccatcg caagctcgcc tccttgctgg tgtcgcgcat caaggtcatg       540
     tcgcggatgg acatcgccga gaagcgggta ccgcaggatg gccgcatctc attgcgcatc       600
     ggcggccggg cggtggacgt gcgggtttcc accatgccgt ccagctacgg cgagcgggtg       660
     gtgctgcgtc tgctcgacaa gaacaacgtg cggctcgagc tcaagcagct cggcatgacg       720
     ctggccaacc gcaacatcat cagcgaactc attcgcaagc cccacggcat cattctggtg       780
     acgggcccga ccggttcggg caagtcgacc accctctacg cggccctctc cgagatcaac       840
     tcgcgggatc gcaacatcct gaccgtcgaa gaccccatcg aatatgacct cgaaggggtg       900
     ggccagaccc aggtcaacag caaggtggac atgaccttcg cccgcggcct gcgcgccatt       960
     ctgcgccaag acccggacgt ggtgatggtg ggggaaattc gtgacctcga gaccgcccag      1020
     atcgcggtgc aggcgtcgct gaccggtcac ctggtgatgt cgaccctgca caccaacacc      1080
     gccatcggtg ccatcacccg gatgcgggac atgggcatcg agcccttcct gctctcctcc      1140
     tcgctgctgg cggtactggc ccagcggctg gtgcgcaccc tctgccccga ttgccgcgcg      1200
     ccgcgcgcca tcaccgagca ggagcgcatt gccatgggca tcgagctggc gccggatcag      1260
     caggtgtggc ggccggtggg ctgcgagcag tgcaaccaca ccggctatcg cggccggacc      1320
     ggcatccacg agctggtggt gatcgacgaa gcggtgcgcg aggcgatcca cagcgccagc      1380
     ggcgagctgg ccatcgagcg gctgatccgg ggccacaccc ccagcattcg ccgcgacggc      1440
     atcgacaagg tactcaaggg gcagaccagc ctcgaagagg tgctgcgcgt gacccgggaa      1500
     gactga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page