(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPF

CP000462.GSPF        Location/Qualifiers
FT   CDS_pept        607271..608491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="AHA_0571"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38224"
FT                   /db_xref="GOA:A0KFS8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS8"
FT                   /protein_id="ABK38224.1"
FT                   /translation="MAAFEYKALDGKGRNKSGVLEGDSARQVRQLLREQGLTPLEVNET
FT                   TEKAKREANRFVLFRRGASTAELAMITRQLATLVGAGLTIEEALKAVAEQCEKAHLRSM
FT                   VATVRSKVVEGYSLADSLAAFPHVFDQLFRSMVAAGEKSGHLEKVLNRLADYTEQRQHM
FT                   RTKLLQAMIYPIVLTCVAIGVISILLTAVVPKVVAQFEHMGQQLPATTRFLIGTSELMQ
FT                   HYGLWFLLLLLVGGFVWRWWLTDDKRRRHWHQLILRLPVIGRVSRGLNTARFARTLSIL
FT                   NASAVPLLEGMKISGEVLSNDFARMRIGEATERVREGTSLRKSLDETKIFPPMMLHMIA
FT                   SGEQSGELDNMLERAADNQDREFETQVNIALGVFEPMLVVSMAGVVLFIVMSILQPILE
FT                   LNNMVNL"
     atggcagcat tcgaatacaa ggccctcgac ggcaagggac gcaacaagag cggcgtgctg        60
     gagggggatt ccgcccgcca ggtacgccag ctgttgcgcg agcaggggct gaccccgctc       120
     gaggtgaacg agaccaccga gaaggccaag cgcgaggcga accgcttcgt gttgttccgc       180
     cgtggtgcca gcaccgccga gcttgcgatg attacccgcc agctggctac cctggtgggg       240
     gccgggctca ccatcgaaga ggcgctcaag gccgtcgccg agcagtgcga gaaggcccac       300
     ctgcgcagca tggtggccac ggtgcgcagc aaggtggtgg agggctattc gctggccgac       360
     tcgctggcgg ccttccccca tgtgttcgat cagctgttcc gctccatggt ggcggccggc       420
     gagaagtccg gtcacctgga gaaggtgctc aaccgcctcg ccgactacac cgagcagcgt       480
     cagcacatgc gcaccaagct gctgcaggcg atgatctacc ccatcgtatt gacctgcgtc       540
     gccatcggcg ttatctccat cctgctcacc gccgtggtgc ccaaggtggt ggcccagttt       600
     gaacatatgg gtcagcaact gccggccacc acccgtttcc tcatcggtac cagcgagctg       660
     atgcagcact acggcctctg gttcctgttg ctgctgctgg tgggtggctt tgtctggcgc       720
     tggtggctga ccgatgacaa gcgtcgacgt cactggcacc agctgatcct gcgcctgccg       780
     gtgatcggtc gggtcagccg tggtctcaac accgcccgtt ttgctcgcac cctgagcatc       840
     ctcaacgcca gcgccgtgcc gctgctggag gggatgaaga tctccggcga agtgctctcc       900
     aatgactttg cccgcatgcg catcggtgag gccaccgagc gggtgcggga ggggaccagc       960
     ctgcgcaagt cgctggatga aaccaaaatt tttccgccca tgatgctgca catgatcgcc      1020
     tccggcgagc agagcggcga gctcgacaac atgctggagc gggcggcgga caaccaggat      1080
     cgggagttcg aaacccaggt gaacatcgcc ctcggggtgt tcgaacccat gctggtggtc      1140
     tccatggccg gggtggtgct gtttatcgtg atgtcgatcc tgcagccgat ccttgagctc      1200
     aacaatatgg tgaatctgta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page