(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPG

CP000462.GSPG        Location/Qualifiers
FT   CDS_pept        608607..609038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="AHA_0572"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by similarity to SP:P31733; match to
FT                   protein family HMM PF07963; match to protein family HMM
FT                   TIGR01710; match to protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38698"
FT                   /db_xref="GOA:A0KFS9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS9"
FT                   /protein_id="ABK38698.1"
FT                   /translation="MQKRRQSGFTLLEVMVVIVILGILASLVVPNLMGNKEKADQQKAV
FT                   SDIVALENALDMYKLDNNRYPTTEQGLDALVNKPTAAPEPRSYREGGYIKRLPQDPWGN
FT                   PYQMLSPGQFGKIDIFSMGLDGEAGTDDDIGNWNLKDFQ"
     atgcaaaagc gtcgtcaatc gggttttacc ctgctggaag tgatggtggt catcgtgatc        60
     ctggggatcc tggccagcct ggtggtgccc aacctgatgg gcaacaagga gaaggcggac       120
     cagcagaaag cggtctccga catagtggcg ctggaaaacg ccctcgacat gtacaagctg       180
     gacaacaacc gctacccgac caccgagcag gggctggacg cgctggtcaa caagccgacc       240
     gcagcacctg agccgcgcag ctaccgcgaa gggggctaca tcaagcgcct gccgcaggat       300
     ccctggggca acccgtacca gatgctgagc ccgggccagt tcggcaagat cgacatcttc       360
     tccatggggc tggatggcga agccggtacc gatgacgaca tcggcaactg gaacctgaag       420
     gacttccaat aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page