(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPH

CP000462.GSPH        Location/Qualifiers
FT   CDS_pept        609202..609753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="AHA_0573"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by similarity to SP:P31735; match to
FT                   protein family HMM TIGR01708; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38394"
FT                   /db_xref="GOA:A0KFT0"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT0"
FT                   /protein_id="ABK38394.1"
FT                   /translation="MKHSRQAGFTLLEVLLVAMLMGLVATAVTLSMGGARGDRELDKQA
FT                   RRFMAVLQQAQEYSVMDGRLVGLRVEDNSWQFMQRAAKDRKWQVMSGDKLLDRVELPDN
FT                   MRLAIELEGFSWRTESDEKYEKGRDEKERTPQVFIFPGGELTPFVLTLTQQDDDLRYVR
FT                   TVKADEFGRLRLLQDEEEEE"
     atgaaacata gtcgccaggc cggttttacc ctgctggaag tgttgctggt cgccatgttg        60
     atggggctgg ttgccactgc cgtcaccctc agcatgggtg gcgccagggg ggatagagag       120
     ctggacaagc aggcgcgccg cttcatggcc gtgctgcagc aggcgcagga gtactcggtg       180
     atggatggcc ggctggtggg cctgcgtgtc gaggacaaca gctggcagtt catgcagcgc       240
     gcggccaagg atcgcaagtg gcaggtgatg agcggtgaca agctgctgga tcgggtcgag       300
     ttgcccgaca acatgcggct ggccatcgag ctcgagggct tcagctggcg gaccgaatcc       360
     gacgagaagt acgagaaggg gcgcgacgag aaggagcgca ccccgcaggt gttcatcttt       420
     cccggtggcg agctgacccc cttcgtgctg accctgaccc agcaggacga cgatctgcgc       480
     tatgtgcgca cggtcaaggc ggacgagttc ggccgtctgc gtctgctgca ggacgaggag       540
     gaagaggaat ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page