(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPI

CP000462.GSPI        Location/Qualifiers
FT   CDS_pept        609750..610109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="AHA_0574"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by similarity to SP:P31737; match to
FT                   protein family HMM PF02501; match to protein family HMM
FT                   PF07963; match to protein family HMM TIGR01707; match to
FT                   protein family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38055"
FT                   /db_xref="GOA:A0KFT1"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT1"
FT                   /protein_id="ABK38055.1"
FT                   /translation="MNARGMTLLEVMVALAVFAIAGLAVMKTASEHLSGLNYLEQKTLA
FT                   TWVVENQLVQQKLEAKWPGDSWVEGDEQMAGQTWYWRYRGVATADSNFKALDMEVRTTP
FT                   KADSPVAMIRTYISR"
     atgaacgccc gcggcatgac cctgctggaa gtcatggtgg cgctggcggt gtttgccatc        60
     gccgggctgg cggtgatgaa gaccgccagc gagcacctct ccggcctcaa ctatctggaa       120
     cagaagaccc tggcgacctg ggtggtggag aaccagctgg tacagcagaa gctcgaagcc       180
     aagtggcccg gtgacagctg ggtggaaggg gacgagcaga tggcgggcca gacctggtac       240
     tggcgctatc gcggcgtcgc taccgccgac agcaacttca aggcgctgga catggaagtg       300
     cgtaccacgc ccaaggctga cagcccggtg gccatgattc ggacctatat cagccgatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page