(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPK

CP000462.GSPK        Location/Qualifiers
FT   CDS_pept        610897..611922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="AHA_0576"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by similarity to SP:P31760; match to
FT                   protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39209"
FT                   /db_xref="GOA:A0KFT3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT3"
FT                   /protein_id="ABK39209.1"
FT                   /translation="MAIKRGRGRSRTTPGRQGGMALLVVLLILSVMVIIASNMSGRLQL
FT                   ELRRTANLTAGKQAWWYAMSAEALVSKVLAQDFKDDPNVVSLGQNWARQDAVFPVDDGK
FT                   LTGRVRDLQSCFNLNSLSVPLKDGISGDDLEKQPYPVKVFKALLKQLEVEDYEAVQLTD
FT                   AIRDWTDKDTVLVSSYGAEDAYYEGLTPPYLTANQWMLGTDELRAVRGVSAKLYARLAP
FT                   YVCALPNDKLVVNVNTIRPEQSALLVALYLDKVGLDDAKRVLTSRPQKGWKNKKEMTDQ
FT                   MPVQVGNIQGLDAALDVKSSYFEARLIAEVGDTRARLESVFVRGKDNKLVMLRRLNGGA
FT                   E"
     atggcaatta agcgcggccg gggccgatcc cgcaccacac cgggccgcca ggggggcatg        60
     gccctgctgg tggtgctgct catcctgtcg gtgatggtga tcatcgccag caacatgagt       120
     ggtcgcctgc agctggagct gcgtcgcacc gccaacctca ccgccggcaa gcaggcctgg       180
     tggtatgcca tgtcggcgga ggcgctggtg agcaaggtgc tggcccagga tttcaaggac       240
     gaccccaacg tggtcagcct ggggcagaac tgggcgcgcc aggatgcggt cttcccggtg       300
     gatgacggca agctcaccgg ccgggtgcgg gatctgcaat cctgcttcaa cctcaacagc       360
     ctgagcgtgc cgttgaagga cgggatcagt ggcgacgatc tggagaagca gccctatccg       420
     gtcaaggtgt tcaaggcgct gctcaagcag ctcgaggtgg aagattatga ggcggtgcag       480
     ctgaccgatg ccatccgcga ctggaccgac aaggataccg tgctggtgtc gagctacggc       540
     gccgaggatg cctattacga agggctcacc cccccttatc tgaccgccaa ccagtggatg       600
     ctcggcaccg acgagctgcg ggcggtgcgc ggggtgagcg ccaagctgta cgcccggctg       660
     gcaccctatg tgtgcgccct gcccaacgac aagctggtgg tgaacgtcaa caccatccgg       720
     ccggagcagt cggccctgct ggtggcgctc tatctggaca aagtagggct ggacgatgcc       780
     aagcgggtgc tgaccagccg cccccagaag gggtggaaga acaagaagga gatgacggac       840
     cagatgccgg tacaggtggg caacatccag gggctggatg cggcactgga cgtcaagagc       900
     agctatttcg aggccaggct gattgccgag gtgggtgaca cccgcgcccg gctggagagc       960
     gtcttcgtgc gcggcaagga caacaagctg gtgatgctgc gccgtctgaa cggcggcgcc      1020
     gaataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page