(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPL

CP000462.GSPL        Location/Qualifiers
FT   CDS_pept        612042..613226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="AHA_0577"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37063"
FT                   /db_xref="GOA:A0KFT4"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT4"
FT                   /protein_id="ABK37063.1"
FT                   /translation="MSESLVIRLGTNAQQPVEWLVWSGGEEEVIASGTLASAHALGELQ
FT                   ERAGGRPAVVLVPGSDLIFRRVSLPGKYSRQSAAALPYLLEEQIASDVDELHLVVLGHQ
FT                   GHEVDLMAVDKEKMQTWLGWLEQAGLKSRQLLPDVLALPQASEGWSALQLGKEWLLRQG
FT                   PCQGIVADEPLLAMLLAAEPAPVTIHSHTPPPAIAAASWQAADPELPMLLLARGALASQ
FT                   ANLLQGPYRPQTEYSRYWQQWRKVAVVAGALLVVAFAQRGVQLYQLAEQDKALKAEIRQ
FT                   VYTRIFPGESRIVNVRSQMTQHLQQLGQTPQDGVLMVLTELAPTFAEVPGLKPEVLRFD
FT                   AARGELRLQVTAPGFAEIERFRELAGKRFDVQQGEVRSTEGKVEGALVLKGKSS"
     gtgagcgaga gtctggtcat ccgtctgggg accaatgcgc agcagccggt cgagtggctg        60
     gtgtggtcgg gtggggaaga ggaggtgatc gcctccggta ccctggcctc ggcccatgcc       120
     cttggcgagc tgcaggagcg ggccggtggc cgcccggcgg tggtgctggt gcccggcagc       180
     gatcttatct tccggcgggt gagcctgccg ggcaaataca gccgccagag tgcggccgcc       240
     ttgccctatc tgctggagga gcaaatcgct tccgacgtgg atgagctgca cctggtggtg       300
     ctgggtcatc agggtcacga ggtggatctg atggcggtcg acaaggagaa gatgcagacc       360
     tggctcggct ggctggagca ggccggtctc aagagccggc aactgctgcc ggacgtgctg       420
     gcgctgccgc aggcgagcga gggctggtcg gcgctgcaac tgggcaagga gtggctgctg       480
     cgccaggggc cctgtcaggg catcgtcgcc gacgagccgc tgctggccat gctgctggcg       540
     gcagaaccgg cgccggtgac cattcacagc cataccccgc cgccggccat tgcggcggcc       600
     agctggcagg cggccgatcc cgagctgccc atgctgctgc tggcccgtgg cgcgctcgcc       660
     agtcaggcca acctgctgca ggggccctac cggccgcaga ccgaatactc ccgctactgg       720
     cagcagtggc gcaaggtggc ggtggtggcc ggggcgctgc tggtggtggc gttcgcccag       780
     cgcggcgtgc agctctatca gctggcggag caggacaagg cgctcaaggc ggagatccgg       840
     caggtctaca cccggatctt cccgggggag agccgcatcg tcaacgtgcg cagccagatg       900
     acccagcacc tccagcaact ggggcagacg ccgcaggacg gggtgctgat ggtgctgacc       960
     gagctggccc ctaccttcgc cgaggtaccc ggcctcaagc ccgaggtgct gcgtttcgac      1020
     gcggctcgcg gcgagctcag gctgcaggtg acggcccccg gttttgccga gatcgagcgt      1080
     tttcgcgagc tggccggcaa gcgcttcgac gtgcagcagg gggaggtgcg cagcaccgaa      1140
     ggcaaggttg aaggggcact ggtgctgaag ggtaaatcat catga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page