(data stored in ACNUC7421 zone)

EMBL: CP000462.GSPN

CP000462.GSPN        Location/Qualifiers
FT   CDS_pept        613776..614531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="AHA_0579"
FT                   /product="bacterial type II secretion system protein N"
FT                   /note="identified by match to protein family HMM PF01203"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35923"
FT                   /db_xref="GOA:A0KFT6"
FT                   /db_xref="InterPro:IPR000645"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFT6"
FT                   /protein_id="ABK35923.1"
FT                   /translation="MKQRVLIAVLFLAAYLVFLLAKLPASLVVRYLPLPPLVQLEGVSG
FT                   TLWSGQVARLQYASESLTQLRWELNGWSLLRFAPEVSLRFGERSGLNGQGVVGWSGAAF
FT                   GRDITLNVPAPWLLARVPMQLPVPVTVAGQLQLKLDQVAQGNPWCDNLYGNLYWYGADA
FT                   DTPAGKLVLGDPEIKLTCIDSRLVAELKQGSEAVQVQGKLELQANRQYLFQGTLKPGPD
FT                   LPEQMKQGLPFLGQPDGQGRFPLRYQGRI"
     atgaagcaaa gagtgctgat tgccgtgctg tttctggcgg cctatctggt tttcctgctg        60
     gccaagctgc cggcgtctct ggtggtgcgc tacctgccgc tgccgcccct ggtacagctg       120
     gaaggggtga gcggcaccct ctggagcggc caggttgccc gcctgcaata cgccagtgag       180
     tcgctgaccc agctgcgctg ggagctcaac ggctggtcgc tgctgcgttt tgcccctgag       240
     gtgtccctgc gctttggcga gcgcagcggc ctcaacgggc agggggtggt tggttggagc       300
     ggcgccgcct ttggccgcga catcaccctc aacgtgccgg ccccctggct gctggcgcgg       360
     gtgccgatgc aactgcccgt gccggtgacg gtggctggcc agctgcagct caagctcgat       420
     caggttgccc agggaaaccc ctggtgcgac aacctctacg gcaacctcta ctggtacggg       480
     gccgatgccg ataccccggc cggcaagctg gtgctggggg atcccgagat caagctgacc       540
     tgcatcgact cccggctggt ggccgagctc aagcagggct cggaggcggt gcaggtgcag       600
     ggcaagctgg agctgcaggc caatcgccag tacctgttcc agggcacgtt gaaacccggg       660
     cccgatctgc cggagcagat gaagcagggg ctgcccttcc tcggccagcc cgatggtcag       720
     gggcgcttcc cgctgcgcta ccagggccgc atctga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page