(data stored in ACNUC7421 zone)

EMBL: CP000462.GYRB

CP000462.GYRB        Location/Qualifiers
FT   CDS_pept        3883..6294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AHA_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P06982; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37959"
FT                   /db_xref="GOA:A0KEE9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEE9"
FT                   /protein_id="ABK37959.1"
FT                   /translation="MSENTYDSSNIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVV
FT                   DNSIDEALAGYCSDIQVKIHSDGSVSVRDNGRGIPVDIHPEEGRSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSDKLLLTIRRNGHVYEQTYHLGEPQAPLKQIGDSTG
FT                   TGTEVRFWPSPTIFSDTLFHYEILAKRLRELSFLNSGVSIRLLDERDGREAHFCYEGGI
FT                   KAFVEYLNQNKTPIHPKVFHFTTEQDGIGVEVAMQWNDAYQEGVYCFTNNIPQRDGGTH
FT                   LVGFRTALTRTLNSYMDKEDYSKKAKSAASGDDVREGLIAVISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVEQAMGEKLADFLLENPGDAKIVVNKIIDAARAREAARKARELTRRKGALD
FT                   IAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMISSQEVGTLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGAHIRTLLLTFFYRQ
FT                   MPEIIERGYVYIAQPPLYKVKKGKQEQYLKDEDALLQYQTAMALDGATLHVNESAPAIG
FT                   GEALERLVNQHRSVSHLITRMSRRAPEAVLTQLIYQPELNEALLSSESDLLAWCQSMEA
FT                   VLNESNHGIQYQMQVRHDEERRLFVPHAVVRQHGVDREYPLSYDFLQSSEYRQLVSLGK
FT                   EIANLIEEGGYIKRGEKVKPVASFVEAVEWLMGEGKRGIYIQRYKGLGEMNPDQLWETT
FT                   MDPEARRMLRVTIDDAVGADQLFSTLMGDAVEPRRDFIETNALRVANLDV"
     atgagtgaaa atacttacga ctcctcgaat atcaaggtac tgaagggcct ggatgcggtc        60
     cgcaagcgcc cggggatgta tatcggcgat acggatgatg gctcgggtct gcaccacatg       120
     gtgttcgagg tcgtcgacaa ctccattgac gaggctctgg ccggctactg ctccgatatt       180
     caggtcaaga tccattccga cggttccgtc tccgtccgtg acaacggtcg tggtattcct       240
     gtcgacatcc acccggaaga gggtcgctcc gctgccgaag tcatcatgac cgtgctgcac       300
     gcgggcggca agttcgacga caactcctac aaggtctccg gcggcctgca cggtgtcggc       360
     gtctccgtgg taaacgccct ctctgacaag ctgctgctga ccatccgtcg caacggccat       420
     gtctacgagc agacctatca cctgggtgag ccgcaggcac cgctcaagca gattggcgac       480
     agcaccggca ccgggaccga agtccgcttc tggccgagcc cgaccatctt cagcgatacc       540
     ctgttccact acgagatcct ggccaagcgt ctgcgcgagc tctccttcct caactccggc       600
     gtctccatcc gcctgctgga tgagcgtgac ggccgcgagg cgcacttctg ctacgaaggc       660
     ggcatcaagg cgttcgtcga atacctgaac cagaacaaga ccccgatcca cccgaaggtg       720
     ttccacttca ccaccgagca ggatggcatc ggtgtggaag tagcgatgca gtggaacgac       780
     gcctatcagg aaggggtcta ctgcttcacc aacaacattc cgcagcgcga tggtggtacc       840
     cacctggtgg gcttccgtac cgcgctgacc cgtactctga actcctacat ggacaaagag       900
     gactacagca agaaggccaa gtctgccgcc agtggcgacg acgtgcgtga aggtctgatt       960
     gccgttatct ccgtcaaggt accggatccc aagttctcct cccagaccaa ggacaagctg      1020
     gtctcttccg aagtgaagac cgccgtcgaa caggcgatgg gtgagaagct ggccgacttc      1080
     ctgctggaaa acccgggcga cgccaagatc gtggtcaaca agatcatcga tgcggcccgt      1140
     gcccgcgaag cggcccgcaa ggcccgcgaa ctgacccgcc gcaaaggcgc gctggatatc      1200
     gccggtctgc ccggcaagct ggccgactgt caggaaaaag acccggcgct ctccgaactc      1260
     tacatagtgg aaggggactc tgctggcggt tccgccaagc agggtcgcaa ccggaagaac      1320
     caggccatcc tgccgctcaa gggcaagatc ctgaacgtgg agaaggcccg tttcgacaag      1380
     atgatctctt cccaggaggt gggcaccctg atcaccgcac tgggctgcgg catcggtcgt      1440
     gacgagtaca acccggacaa gctgcgttat cacaacatca tcatcatgac cgatgcggac      1500
     gtcgatggtg cgcacattcg taccctgctg ctgaccttct tctatcgtca gatgccggaa      1560
     atcatcgaac gtggctacgt ctacatcgcc cagccgccgc tctacaaggt gaagaagggc      1620
     aagcaggagc agtatctgaa agacgaagat gcgctgctgc agtaccagac cgccatggcg      1680
     ctggacggtg cgaccctgca cgtcaacgag tctgccccgg ccatcggtgg cgaggcgctg      1740
     gagcgtctgg tcaaccagca tcgctcggtg tctcacctga tcacccgcat gtctcgccgc      1800
     gcgccagaag ccgtgctgac ccagctgatc tatcagccgg agctgaacga agcgctgctg      1860
     agcagcgaga gcgatctgct ggcctggtgc cagagcatgg aagccgtgct caacgagagc      1920
     aaccatggca tccagtacca gatgcaggtt cgccacgacg aagagcgccg tctgttcgtg      1980
     ccgcacgccg tggtacgcca gcacggggtc gaccgcgaat acccgctcag ctacgacttc      2040
     ctgcaatcct ccgagtaccg tcaactggtc tcgctgggca aggagatcgc caacctgatc      2100
     gaggaaggtg gttacatcaa gcgtggcgag aaggtgaagc cggtcgccag cttcgtcgaa      2160
     gcggtcgagt ggctgatggg cgaaggcaag cgcggcatct acatccagcg ctataaaggg      2220
     ctgggcgaga tgaacccgga ccagctgtgg gaaaccacca tggatcctga agcccgtcgc      2280
     atgctgcgcg tcaccatcga cgatgccgtc ggtgccgacc agctcttctc caccctgatg      2340
     ggtgatgccg ttgagccacg ccgtgacttc atcgagacca acgccctgcg cgttgccaac      2400
     ctcgacgtct aa                                                          2412
//

If you have problems or comments...

PBIL Back to PBIL home page