(data stored in ACNUC7421 zone)

EMBL: CP000462.HEMD

CP000462.HEMD        Location/Qualifiers
FT   CDS_pept        complement(498177..498911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="AHA_0468"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37538"
FT                   /db_xref="GOA:A0KFH5"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFH5"
FT                   /protein_id="ABK37538.1"
FT                   /translation="MIPLVVRPAAQAAELAALLRQHGHAPLCCPLLETVAGSELHRLPE
FT                   LLPQADIVIAVSVHAVNFTHHFLLQTGQTWPNIDYFAVGQASADAFSEVGIQALSPDDP
FT                   RSEGLLALPSLQQVNGKQVLILRGNGGRDLIARTLASRGALVHYCAAYERHYPALDGDA
FT                   LTCHWQAAGLDSLLVTSGELLQRLLELVPDQQLPWLHDRLLVVPSPRVAEMAAAAGFTH
FT                   ITIAQGASNQALTAALELRKME"
     atgatcccgc tggtggtgcg cccggccgcc caggccgccg agctggcggc gctgctgcgc        60
     cagcacggcc acgcaccgct ctgctgcccg ctgctggaaa ccgtggcggg cagcgaactg       120
     caccgcctgc ccgaactgct gccccaggcc gacatcgtca tcgccgtcag cgtgcatgca       180
     gttaatttca ctcatcattt tctgttgcaa actggtcaga cctggccaaa tattgactac       240
     tttgcagtcg gccaggccag cgcggatgcc ttctctgagg tgggcatcca ggccttgagc       300
     ccggacgatc cgcgcagcga agggctgctg gccctgccca gcctgcaaca ggtgaacggc       360
     aagcaggtgc tgatcctgcg cggcaatggc ggccgggatc tcatcgcccg gacgctggcc       420
     tcacgcggcg cactggtgca ctattgtgcg gcctatgagc gccactaccc cgcactggac       480
     ggggacgcat tgacttgcca ctggcaggcg gccgggctcg acagcctgct cgtcaccagc       540
     ggtgaactgc tgcaacggct gctggaactg gtcccggacc aacagctgcc ctggctgcac       600
     gaccgcctgc tggtggtgcc cagcccgcgg gtggccgaga tggccgcggc ggcgggcttt       660
     acccatatca cgattgccca gggtgcatcc aaccaggccc tgacggccgc tctggaactg       720
     aggaagatgg aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page