(data stored in ACNUC7421 zone)

EMBL: CP000462.HEMF

CP000462.HEMF        Location/Qualifiers
FT   CDS_pept        288492..289400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="AHA_0265"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="identified by match to protein family HMM PF01218"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36850"
FT                   /db_xref="GOA:A0KEX7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX7"
FT                   /protein_id="ABK36850.1"
FT                   /translation="MSKPDVAQVKAFLLQLQDEICRGLELADGAGHFVEDAWRREGGGG
FT                   GRTRVLRHGAVIEQGGVNFSHVHGDAMPASATAHRPELAGRRFEAMGVSLVIHPHNPYV
FT                   PTSHANVRFFIAEKEGEEPIWWFGGGFDLTPFYPFEEDVRHWHQLSRDLCQPFGTDIYP
FT                   EFKSWCDRYFFLKHRDETRGVGGLFFDDLNRWPFADCFAFMQAVGKGYLDAYLPIVERR
FT                   KALAYGEREREFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLARWEYDWQ
FT                   PSAGSPEALLYSDYLKPREWL"
     atgagcaaac cggatgtggc ccaggtcaag gccttcctgc tgcagttgca ggacgagatc        60
     tgccgtggtc tggaactggc cgacggcgcc ggacactttg tggaagatgc ctggcgccgc       120
     gaaggaggtg gcggtggccg cactcgtgtg ctgcgtcacg gtgctgtgat cgagcaggga       180
     ggggtcaact tctcccacgt tcatggtgac gccatgcctg cctcggcaac ggcccatcgg       240
     ccggaactgg cgggccgccg gtttgaggcc atgggggtgt cgctggtgat ccacccacac       300
     aatccgtacg tgccgaccag ccacgccaat gtgcgcttct tcatcgccga gaaagagggg       360
     gaggagccga tctggtggtt tggtggcggc ttcgatctca ccccgtttta tccgttcgaa       420
     gaggacgtgc ggcattggca tcagctctcc cgcgatcttt gtcagccgtt cggcaccgac       480
     atttatcccg agttcaaatc ctggtgtgat cgctacttct tcctcaagca ccgggacgag       540
     acgcgcggcg tcggcggcct cttcttcgat gatctgaatc gctggccgtt tgccgactgt       600
     ttcgccttta tgcaggcggt cggcaagggc tatctcgatg cctacctgcc gattgtcgag       660
     cgccgcaagg cgctggctta tggcgaacgg gagcgggaat tccagctcta tcgtcgtggc       720
     cgctatgtgg agttcaatct ggtgtatgac cgtggcaccc tgttcggctt gcagacaggc       780
     gggcgtaccg agtcgatcct gatgtcgatg ccaccgctgg cgcgctggga atatgactgg       840
     cagccgtccg cgggcagccc ggaggcattg ctctacagcg actacctcaa accacgcgag       900
     tggttgtga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page