(data stored in ACNUC7421 zone)

EMBL: CP000462.HSLO

CP000462.HSLO        Location/Qualifiers
FT   CDS_pept        complement(601255..602142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="AHA_0566"
FT                   /product="33 kDa chaperonin HslO"
FT                   /note="identified by similarity to SP:P0A6Y5; match to
FT                   protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39863"
FT                   /db_xref="GOA:A0KFS3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS3"
FT                   /protein_id="ABK39863.1"
FT                   /translation="MMSNQDLLYRYLFEEYEVRGELVQLDHTYRHVVEAQNYPVQVQKL
FT                   LGELLVATSLLTATLKFEGSITVQLQGNGPVRLAVINGDNNQQLRGVARYEGELPSDDK
FT                   LQSLIGEGQLVITITPEQGERYQGIIALDADTLAGCLEHYFAQSEQLATKLWIRTGYHQ
FT                   GEPRAAGILLQELPAQSEDHSDDFEHLTQLTSTIKDEELFGLEAEEILYRLYHQDKVRV
FT                   FDPQAVEFRCTCSRARCEGALLQIEKEEVMEMVQELGKIDMHCDYCGAQYQFDGIDVET
FT                   LFSRAPGNDANKLH"
     atgatgagta accaagatct cctgtatcgc tatctgttcg aagagtacga agtccggggc        60
     gagctggtcc agctggacca cacctaccgc cacgtggttg aggcccagaa ctacccggta       120
     caggtgcaaa aactgctggg tgaactgctg gtcgccacca gcctgctgac cgccaccctc       180
     aagttcgaag gctccatcac ggtgcagctg cagggcaacg gcccggtacg gctggccgtc       240
     atcaacggcg acaacaatca gcagctgcgt ggtgtggccc gctatgaagg ggaactgccg       300
     agcgacgaca agctgcagag cctgatcgga gaaggccagc tggtcatcac catcaccccg       360
     gagcagggtg aacgctatca gggcatcata gcgctggacg ccgacaccct ggctggctgc       420
     ctggagcact acttcgccca gtccgaacag ctggcgacca agctgtggat ccgtaccggc       480
     taccaccagg gtgagccgcg cgccgccggc atcctgctgc aggagctgcc tgcccagagc       540
     gaggatcaca gcgacgattt cgagcacctg acccagctca ccagcaccat caaggatgaa       600
     gagctgttcg gtctggaagc ggaagagatc ctctaccgcc tctaccacca ggacaaggtg       660
     cgggtgttcg atccgcaggc ggtcgagttc cgctgcacct gctcccgcgc ccgttgcgaa       720
     ggggctctgc tgcagataga aaaggaagag gtcatggaga tggtgcagga gctcggcaag       780
     atcgacatgc actgtgatta ttgcggcgcc cagtaccaat ttgatgggat cgacgtcgaa       840
     accctgttca gcagggctcc cggtaatgat gcaaacaagt tacactaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page