(data stored in ACNUC7421 zone)

EMBL: CP000462.HUTC

CP000462.HUTC        Location/Qualifiers
FT   CDS_pept        392142..392846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutC"
FT                   /locus_tag="AHA_0376"
FT                   /product="histidine utilization repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702; match to protein
FT                   family HMM TIGR02018"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35932"
FT                   /db_xref="GOA:A0KF83"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF83"
FT                   /protein_id="ABK35932.1"
FT                   /translation="MAPALYLQIKQHILDGIRERHYQAGDRIPTEAALCEQFAVSRMTV
FT                   NKALRELVAEGWLVRTAGSGSFVADRRTESPLLAIRNIADEIAERGSEYSGRVIRLQRQ
FT                   AADEKVAVQLGLRVGAPIFHSLIVHQADGEPLQLEERFVDAERLPQYGEQDFASQTPNR
FT                   YLMEVCPLSEMEHVVEAVLPSAGEAGLLQVRVDTPCLLLHRRTWSDGYLVSYARLLSPG
FT                   SRYKLSSKTSLS"
     ttggcaccgg ccctctatct gcagatcaag cagcacatcc tggacgggat ccgcgaacgc        60
     cactatcagg cgggcgaccg gatcccgacc gaggccgccc tgtgcgaaca gttcgccgtg       120
     agccggatga cggtcaacaa ggcgctgcgc gagctggtgg ccgagggctg gctggtgcgc       180
     accgccggct ccggcagctt cgtggcggac aggcgcaccg aatcgccgct gctggccatt       240
     cgcaacatcg ccgacgagat cgccgagcgg ggcagcgagt acagcggccg ggtgatccgg       300
     ctgcagcgcc aggccgccga cgagaaggtg gcggtgcagc tgggcctgcg ggtcggcgcc       360
     cccatcttcc acagtctcat cgtccatcag gccgatggtg agccgctgca gctggaagag       420
     cgcttcgttg atgccgagcg gctgccacag tacggtgagc aggattttgc cagccagacc       480
     cccaaccgct atctgatgga ggtctgccct ctctccgaga tggagcacgt ggtggaggcg       540
     gtgctgccga gcgccggtga ggccggcttg ttgcaggtgc gggtcgacac cccctgcctg       600
     ctgctgcacc ggcgtacttg gtccgacggt tatctggtct cctatgcccg tttgctctcg       660
     ccgggctccc gttacaagtt gagttccaag accagtctca gttaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page