(data stored in ACNUC7421 zone)

EMBL: CP000462.HUTH

CP000462.HUTH        Location/Qualifiers
FT   CDS_pept        396943..398475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="AHA_0380"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="identified by match to protein family HMM PF00221;
FT                   match to protein family HMM TIGR01225"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36958"
FT                   /db_xref="GOA:A0KF87"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF87"
FT                   /protein_id="ABK36958.1"
FT                   /translation="MFELTITPGELDLATLRRVSREPVHVSLDPAALAGIHASAAVVTK
FT                   VIEQNRVVYGINTGFGLLANTRIPVEQLDELQRSIVLSHAAGIGEYMDDATVRLMMVLK
FT                   LNSLARGFSGIRLVVLEALMRLINAEVYPVVPKKGSVGASGDLAPLAHMSCLLIGEGKA
FT                   RHAGELIDAATALKIAGLEPIALAPKEGLALLNGTQASTAFALEGLFHAEDLYAGAITI
FT                   GAMSVEAALGSRRPFDARIHAVRGQRGQIDAAACYRHLLVDGSEIGMSHHNCEKVQDPY
FT                   SLRCQPQVMGACLTQIRQAAEVLVCEANAVSDNPLVFAEDEDILSGGNFHAEPVAFAAD
FT                   NLALAIAEIGSLSERRMALLIDSRMSGLPAFLVNNGGVNSGFMIAQVTSAALASENKTL
FT                   AHPASVDSLPTSANQEDHVSMATFAGRRLADMAENTRGILAVELLAAAQGLDFRAPLRS
FT                   TELIELAKGRLREEVSFYDKDRYFAPDIEAAAALLGRASYNDLLPAGVLPSL"
     atgtttgaat tgactattac cccgggcgag ctggatcttg ccaccctgcg ccgcgtcagc        60
     cgcgagccgg tacacgtttc gctggatccc gccgccctgg cggggatcca cgcctccgcc       120
     gccgtggtca ccaaggtgat cgagcaaaac cgggtggtgt acggcatcaa caccggcttt       180
     ggcttgctgg ccaacacccg cattccggtg gagcagctgg acgagctgca gcgctccatc       240
     gtgctctctc atgcggccgg gattggcgag tacatggatg acgccaccgt gcggctgatg       300
     atggtgctca agctcaactc gctggcgcgc ggcttctctg gcatccggct ggtggtgctg       360
     gaggccctga tgcggctgat caacgccgaa gtctatccgg tggtgccgaa gaagggctcc       420
     gtcggtgcct ccggcgatct ggcgccgctg gcccacatga gctgtctgct gatcggggag       480
     ggcaaggccc gccacgctgg cgagctgatc gatgccgcca cggccctgaa gattgccggg       540
     ctcgagccca tcgcgctggc accgaaagag gggctggccc tgctcaacgg cacccaggcg       600
     agcaccgcct tcgcgctgga aggcttgttc cacgccgagg atctctacgc cggcgccatc       660
     accatcggtg ccatgagcgt ggaggccgcc cttggcagcc gccgcccgtt cgatgcccgc       720
     atccatgcgg tgcgcggtca gcgtggccag atcgacgcgg ccgcctgcta tcgccacctg       780
     ctggtggatg gcagcgaaat cggcatgtcc catcacaact gcgagaaggt gcaggatccc       840
     tactccctgc gctgccagcc gcaggtgatg ggcgcctgcc tgacccagat ccgccaggcg       900
     gccgaggtgc tggtgtgcga ggccaacgcg gtctccgaca acccgctggt gtttgccgag       960
     gatgaagaca tcctctccgg cggcaacttc cacgcagaac ccgtggcctt cgccgccgac      1020
     aacctggcgc tggccatcgc cgagataggg tcgctgtccg agcggcgcat ggcgctgctg      1080
     atcgactcgc ggatgtccgg tctgccggcc ttcctagtca acaacggcgg cgtcaactcc      1140
     ggtttcatga tcgcccaggt cacctcggcg gcgctcgcct ccgagaacaa gaccctggcc      1200
     catccggctt cggtggacag cctacccacc tccgccaacc aggaggatca cgtttccatg      1260
     gccaccttcg ccggccgtcg actggcggac atggccgaga acacccgcgg cattctggcg      1320
     gtggaactgc tggcggcagc gcaagggctg gatttccgtg ctcccctgcg cagcaccgag      1380
     ctcatcgagc tggccaaggg ccggctgcgg gaagaggtca gcttctacga caaggacagg      1440
     tacttcgcgc cggacatcga ggcggccgcc gccctgctgg ggcgtgccag ctacaatgac      1500
     ctgctcccgg ccggcgtgtt gccgagcctg taa                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page