(data stored in ACNUC7421 zone)

EMBL: CP000462.ILVC

CP000462.ILVC        Location/Qualifiers
FT   CDS_pept        173624..175105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="AHA_0153"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38758"
FT                   /db_xref="GOA:A0KEM1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM1"
FT                   /protein_id="ABK38758.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMQREEFADGCNVLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRKAAITEKRASWQKATDNGFAVGTYEELIPTADLVLN
FT                   LTPDKQHSDVVKTVMPLMKQGAALGYSHGFNVVEEGQQIRADITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWASATGGDRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCYDKLVAEGTDPAYAGKLIQFGWETITEALKQGGISLMMDRLSNPA
FT                   KLRAFELSEQLKTLMRPLFEKHMDDIIAGEFSRGMMADWAEDDAKLFGWREETGKSAFE
FT                   NAPAFAGKIAEQEYFDNGVVMVAMVKAGVELAFETMVASGIYEESAYYESLHELPLIAN
FT                   TVARKRLYEMNVVISDTAEYGNYLFANAAVPLLREHFMPTLKAGDLGASKAEGQSVDNL
FT                   ALLAANEATRNHPIEKIGQVLRGYMKDMKRIAVGG"
     atggctaact atttcaatac cttgaacctg cgtcagcagt tggcccagct gggcaagtgt        60
     cgtttcatgc agcgcgaaga gttcgcggac ggctgcaacg tgctgaaggg caagaaggtg       120
     gtgattgtgg gctgtggtgc ccagggtctg aaccagggtc tgaacatgcg tgactccggg       180
     ctggatatct cctacgccct gcgcaaggcc gccatcaccg agaagcgcgc ctcctggcag       240
     aaagccaccg acaacggctt cgcggtcggt acctatgaag agctgatccc gaccgccgat       300
     ctggtgctca acctgactcc ggacaaacag cactccgacg tggtgaaaac cgtgatgccg       360
     ctgatgaagc agggcgccgc gctgggttac tcccacggct tcaacgtggt ggaagagggt       420
     cagcagatcc gcgccgacat cactgtcgtc atggtcgcgc ccaagtgccc gggtaccgaa       480
     gtgcgtgaag agtacaagcg cggtttcggc gtacctaccc tgatcgccgt tcacccggag       540
     aacgatccca agggcgaagg catggccatc gccaaggcgt gggcctctgc caccggtggc       600
     gaccgtgccg gcgtgctgga gtcctccttc gtggcggaag tgaaatctga cctgatgggc       660
     gagcagacca tcctctgcgg catgctgcag gccggctccc tgctctgcta cgacaagctg       720
     gttgccgaag gcaccgaccc ggcctacgcc ggcaagctga tccagttcgg ttgggagacc       780
     atcaccgaag ccctgaaaca gggtggtatc agcctgatga tggaccgcct ctccaacccg       840
     gccaagctgc gcgccttcga gctctccgag cagctcaaga ccctgatgcg cccgctgttc       900
     gagaagcaca tggacgacat catcgccggc gagttttccc gcggcatgat ggccgactgg       960
     gccgaagacg atgccaagct gttcggctgg cgcgaagaga ccggcaagtc cgccttcgaa      1020
     aacgccccgg cgtttgcagg caagattgcc gagcaggagt acttcgacaa tggcgtggtg      1080
     atggtggcca tggtcaaggc gggtgtcgag ctggcgtttg agaccatggt ggcctccggc      1140
     atctatgaag agtctgccta ctacgaatcc ctgcacgagc tgccgctgat tgccaacact      1200
     gttgcccgca agcgtctgta cgagatgaac gtggtcatct ccgacaccgc cgagtacggc      1260
     aactacctgt tcgccaacgc cgccgtgccc ttgctgcgcg agcacttcat gccgaccctg      1320
     aaagcaggcg atctgggggc cagcaaggcg gaagggcaga gcgtggataa cctggcgctg      1380
     ctggcggcca acgaagcgac tcgcaaccac ccgatcgaaa aaatcggcca ggtactgcgt      1440
     ggctacatga aggacatgaa acgtatcgcc gttggcggtt aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page