(data stored in ACNUC7421 zone)

EMBL: CP000462.LEXA

CP000462.LEXA        Location/Qualifiers
FT   CDS_pept        200198..200821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="AHA_0183"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /note="identified by similarity to SP:P0A7C2; match to
FT                   protein family HMM PF00717; match to protein family HMM
FT                   PF01726; match to protein family HMM TIGR00498"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36241"
FT                   /db_xref="GOA:Q44069"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44069"
FT                   /protein_id="ABK36241.1"
FT                   /translation="MKPLTPRQAEVLELIKANMNETGMPPTRAEIAQKLGFKSANAAEE
FT                   HLKALAKKGVIEIMPGTSRGIRLLLEEEEPLEESGLPLIGKVAAGEPILAQEHIESHYQ
FT                   VDPALFHPRADFLLRVQGMSMKNIGILDGDLLAVHKTQEVRNGQVVVARLDEDVTVKRF
FT                   QRKGSQVWLLPENEELSPIEVDLSCQQLTIEGLAVGVIRNADWM"
     atgaaacccc ttactccccg ccaggccgaa gtgctggagt tgatcaaggc gaacatgaac        60
     gaaaccggca tgccgccgac tcgcgccgag atagcccaga agcttggttt caagtcggcc       120
     aatgcggccg aggaacatct gaaggccctg gccaaaaagg gggtcatcga gatcatgccg       180
     ggcacgtccc gcggcatccg cctgttgctc gaagaggaag agccgctgga agagagcggt       240
     ctgccgctga tcggcaaggt ggccgccggc gagcccatcc tggcgcagga gcatatcgag       300
     agtcactacc aggtggatcc ggccctgttc cacccgcggg ccgacttcct gctgcgggta       360
     cagggcatga gcatgaagaa catcggcatt ctggatggcg atctgctggc ggtacacaag       420
     acccaggagg tgcgcaacgg ccaggtggtg gtggcacggc tcgacgagga tgtcaccgtc       480
     aagcgcttcc agcgcaaggg cagccaggtg tggctgctgc cggagaacga agagctctcc       540
     cccatcgagg tggatctctc ctgccagcag ctcaccatcg aggggctggc ggtcggcgtc       600
     attcgcaacg ccgactggat gtaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page