(data stored in ACNUC7421 zone)

EMBL: CP000462.MENA

CP000462.MENA        Location/Qualifiers
FT   CDS_pept        567571..568494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="AHA_0533"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by similarity to SP:P32166; match to
FT                   protein family HMM PF01040; match to protein family HMM
FT                   TIGR00751"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39485"
FT                   /db_xref="GOA:A0KFP0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFP0"
FT                   /protein_id="ABK39485.1"
FT                   /translation="MFGHHNMTNTLSIWLLAARLRTLPLACSSILLGSGLAASRGAFDG
FT                   TIMALSLLTAILLQILSNLANDYGDAVSGADNGERIGPQRAVVSGLITRRQMCVAMALT
FT                   ALAAVVSGLALLGCAFGDQWLQILTFVLLGGAAIVAAITYTVGKTPYGYRGFGDISVFL
FT                   FFGLLGVLGSYYLFTKTLQWDLLLPATACGLLATAVLNINNVRDIETDAVSGKITLAVR
FT                   LGRNRAIAYHWVLLGAALLTTIAFLLTQPASFWPWIFLPAMKPLTDAAKTLRQSFDGEV
FT                   LTGALKKTAISAFLFSLLLSIGLALS"
     ttgtttggcc atcacaatat gacaaatacc ttatctattt ggttgctggc ggcgcgtttg        60
     cgaacgttgc cgctggcgtg ctcctccatt ttgctgggtt ccgggcttgc ggccagccgc       120
     ggtgccttcg acggtaccat catggcgctc tccctgctga ccgccattct gctgcagatc       180
     ctctccaatc tggccaacga ttatggggat gcggtatccg gggcggacaa tggcgaacgg       240
     atcggccccc agcgcgccgt ggtctccggc ctcatcaccc gccggcagat gtgcgtggcc       300
     atggcgctga ccgcgctggc cgcagtagtc agcggcctcg ccctgctggg ctgcgctttt       360
     ggcgatcagt ggctgcagat cctcaccttc gtgctgctcg gcggcgccgc catcgtcgcc       420
     gccatcacct acacggtggg caagactcct tacggctatc gcggcttcgg cgacatctcg       480
     gtgttcctgt tcttcggcct gctgggggtg ctcggctcct actacctgtt caccaagacc       540
     ctgcagtggg atctgctgct gccggccacc gcctgcggcc tgctggccac cgcggtgctc       600
     aacatcaaca acgtgcgcga catcgagacc gacgcggtca gcggcaagat caccctggcg       660
     gtgcggctcg gtcgcaaccg ggccattgcc taccactggg tactgctggg ggcggcgttg       720
     ctgaccacca tcgccttcct gctgacccag cccgccagtt tctggccctg gatcttcctg       780
     ccggccatga agccgctcac cgatgccgcc aagaccctgc gccagagttt cgatggcgag       840
     gtgctgaccg gcgcgctcaa gaagaccgcc atcagcgcct tcctgttcag cctgctgctc       900
     tccatcgggc tggcgctctc ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page