(data stored in ACNUC7421 zone)

EMBL: CP000462.MENF

CP000462.MENF        Location/Qualifiers
FT   CDS_pept        complement(566035..567381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="AHA_0532"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /EC_number="5.4.4.2"
FT                   /note="identified by similarity to SP:P38051; match to
FT                   protein family HMM PF00425; match to protein family HMM
FT                   TIGR00543"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38715"
FT                   /db_xref="GOA:A0KFN9"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFN9"
FT                   /protein_id="ABK38715.1"
FT                   /translation="MLAQTHIKQQLDALRHGNASGFVRLRVAIEVGSFLGWLAAQTLYP
FT                   RIYWHARGHDRPEYVALGCLRELTEPQAIRQVCEHTSQPHDDSPRYYGGLAFDPTQPGW
FT                   QGFGPCRFVLPRIELVRRGECVTLCLNLWLPEQTGSDAFEVELQAAAAALDALRPEAPL
FT                   PPLTRHSWQREDCPSQPQWQTLVEQVTAPEFQAHTPKVVLSRQSRLTHDGATLTADPQA
FT                   VAPWSLLASWAQHGQDCFHFGFQFSPEQSFIACSPERLYRREQQHLFTEALAGTIRRSG
FT                   DEATDAALAAELLADSKNRLENRLVHADILSRLAPLTTDATLTEPRILKLRLLQHLKCD
FT                   IEAELKPGVCDWQLLEALHPTPAVGGAPREAALAFIREREPYDRGWYAGACGMLSRETS
FT                   EFSVAIRSARITAQAITLFAGAGIVAGSEPAAEWAELDNKIANVLSLLG"
     atgttggctc agacccatat caagcaacaa ctggacgccc tgcgtcacgg caatgccagc        60
     ggcttcgtgc ggctgcgcgt ggcaatcgag gtcggctcct ttctgggctg gctcgcggcg       120
     cagaccctct atccccgtat ctattggcat gccagaggac acgaccgccc cgaatacgtg       180
     gcgctgggct gcctgcgcga gctgaccgag ccccaggcga tccgccaggt ctgcgaacac       240
     accagccagc cccatgatga cagcccccgc tactatggcg gactggcgtt cgaccccacc       300
     cagcccggct ggcaggggtt cggcccctgc cgcttcgtgc tgccccgcat cgagctggtg       360
     cgccgtggcg agtgcgtcac cctctgcctc aacctctggt tgccggagca gaccggcagc       420
     gacgccttcg aggtcgaact acaggccgcc gccgccgccc tcgacgccct tcggccggag       480
     gcgcctctgc cgccgctgac ccgtcattca tggcaacggg aagattgccc gagccagcca       540
     cagtggcaga ccctggtcga gcaggtcacc gctcccgagt tccaggccca cacccccaag       600
     gtggtgctgt cgcgccagag ccggctcacc catgacggtg cgacgctcac ggccgacccg       660
     caggccgtcg ccccctggtc gctgctggcc agctgggcac agcacggcca ggactgcttt       720
     cacttcggct tccagttttc acccgagcag agcttcatcg cctgctcccc cgagcggctc       780
     tatcgccgcg aacagcagca cctcttcacc gaggcgctgg cgggcaccat ccgccgctcc       840
     ggcgacgagg cgaccgacgc cgcgctggcc gccgaactgc tggccgacag caagaaccgg       900
     ctggaaaaca ggctggtaca cgccgacatc ctcagccggc tggcgccgct taccacagat       960
     gccaccctga ccgagccgcg cattctcaaa ctgcggctgc tgcagcacct caagtgcgac      1020
     atcgaagccg agctcaagcc cggcgtctgc gactggcaat tgctggaggc gctgcacccc      1080
     acccccgcag tgggcggcgc cccccgcgag gcggcgctgg ccttcatccg cgaacgcgag      1140
     ccctatgatc gcggctggta tgccggcgcc tgcggcatgc tgagccggga aacctcggag      1200
     ttctcggtcg ccatccgcag cgcccgcatc acggcgcagg ctatcaccct gtttgccggc      1260
     gccggtatcg tcgcgggttc cgagcctgcc gccgagtggg ccgaactcga caacaagatc      1320
     gccaacgtgc tctccctgct gggatag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page