(data stored in ACNUC7421 zone)

EMBL: CP000462.META

CP000462.META        Location/Qualifiers
FT   CDS_pept        521085..522038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metA"
FT                   /locus_tag="AHA_0489"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="identified by match to protein family HMM PF04204;
FT                   match to protein family HMM TIGR01001"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39388"
FT                   /db_xref="GOA:A0KFJ6"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KFJ6"
FT                   /protein_id="ABK39388.1"
FT                   /translation="MPIKIPDQLPAAEVLGQENIFVMTESRAVTQNIRPLRVLILNLMP
FT                   KKIETEIQLMRMLSNSPLQVDVDLLRIDDRESKNTPQAHLENFYHDFEQVRGNNYDGMI
FT                   ITGAPLGLVEFEEVVYWPRIVEIIEWSHQHVTSTLFLCWAVQAALKALYGMEKQTHGEK
FT                   LSGVYRHHRLDEHEPLLRGFDDEFVAPHSRYAAFDGDLIRAHTDLQIFAESAEAGVYLA
FT                   ATKDCRQVFVTGHPEYDALTLDGEYQRDLAAGLEPVIPVNYYPDNDPTRTPRASWRSHG
FT                   HLLFSNWLNYYVYQLTSYRVEDIGKVFTYQQNSPSR"
     atgccgatca agatcccgga tcagttaccc gccgccgaag tgctggggca ggagaacatc        60
     ttcgtgatga cggaatccag ggccgtcacc cagaacatcc gcccgctgcg ggtgttgatc       120
     ctcaacctga tgcccaagaa gattgaaacc gagatccagc tgatgcggat gctctccaac       180
     tcgccgttgc aggtggacgt ggatctgctg cgcatcgacg atcgggagtc gaagaacacg       240
     ccccaggcgc acctggagaa cttctatcac gacttcgaac aggtgcgcgg caacaactac       300
     gacggcatga tcatcacggg ggcgccgctc gggctggtag agttcgagga ggtggtctac       360
     tggccgcgca tcgtagagat catcgagtgg tcccatcagc acgtgacctc caccctgttc       420
     ctctgctggg cggtgcaggc ggcgctgaaa gccctgtacg gcatggagaa gcagacccac       480
     ggcgagaagc tgtccggggt ctatcgccac caccggctcg acgagcacga gccgctgctg       540
     cgcggcttcg acgacgagtt cgtggcgcct cactcccgct atgcggcgtt cgacggggat       600
     ctcatccgcg cccacaccga tttgcagatc tttgccgaat cggcagaggc cggggtctat       660
     ctggcggcca ccaaggattg tcgtcaggtg ttcgtcaccg gtcatccgga atacgatgcg       720
     ctgaccctgg atggcgaata ccagcgggat ctggcggccg ggcttgagcc cgtcattccg       780
     gtcaactact acccggacaa cgacccgacc cggaccccgc gcgccagctg gcgcagccac       840
     ggccacctgc tgttttccaa ctggctcaac tactacgtct atcagctcac cagctatcgc       900
     gtcgaggata tcggcaaggt gtttacctat cagcagaact cgccgtcgag gtag             954
//

If you have problems or comments...

PBIL Back to PBIL home page