(data stored in ACNUC7421 zone)

EMBL: CP000462.METB

CP000462.METB        Location/Qualifiers
FT   CDS_pept        622690..623853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="AHA_0589"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM TIGR02080"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39105"
FT                   /db_xref="GOA:A0KFU6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU6"
FT                   /protein_id="ABK39105.1"
FT                   /translation="MTHKATQAVRTGIETDQQHGAVVPPIYLSSNYTFADFGEPRQYDY
FT                   ARSGNPTRTNLADALAALEGGAGAVVTGTGMGAVHLVTTALLKAGDLLLAPHDCYGGTW
FT                   RLFEYLAAKGHYRVQFVDQGDAAALAEALAQQPALVWVETPSNPLLRVVDIAAIAEASH
FT                   AAGAKVAVDNTFLSPLLQQPLALGADLVVHSTTKYINGHSDVVGGVAIAKDPELADSLV
FT                   WWANCLGLTSGAFDSYLTLRGLRTLAPRLRAHQENTDRILAFLQQQPLVKRIYHPSLPS
FT                   HPGHDIARRQQSGFGAMLSFELDCSEAGIRAFLAALTLFSVAESLGGVESLVAHPASMT
FT                   HRAMTPAAQQAAGISSQLLRLSVGIEHGEDLVADLAAAFAQAQQVAK"
     atgacccaca aggccaccca agcagtacgc accgggattg agactgacca gcaacacggt        60
     gccgtggtgc cgcccatcta cctctccagc aactacacct ttgccgactt tggcgagccc       120
     cgtcaatacg attatgcccg ctccggcaac ccgacccgca ccaatctggc ggacgcgctg       180
     gcggcgctgg aagggggcgc cggcgccgtg gtgaccggca ccggcatggg ggccgtccat       240
     ctggtgacca cggctctgct caaggcgggg gatctgctgc tcgcccccca cgactgctac       300
     ggcggtacct ggcgcctgtt cgagtacctg gcggccaagg gccactaccg ggtacagttc       360
     gtcgatcagg gggatgcggc ggcactggcc gaagcactgg cccagcagcc cgcactggtg       420
     tgggtggaga ccccctccaa cccgctgctg cgggtggtgg acatcgccgc catcgccgag       480
     gcgtcccacg cggcgggggc caaggtggcg gtggacaaca ccttcctctc gccgctgctg       540
     caacagccgc tggcgctggg ggcggacctg gtggtgcact ccaccaccaa gtacatcaac       600
     ggccactccg acgtggtggg cggggtggcg atcgccaagg atcccgagct ggccgactct       660
     ctggtgtggt gggccaactg tctggggctc acctccgggg cattcgactc ctacctcacc       720
     ctgcgcggtc tgcgcaccct ggcccccaga ttgcgcgccc atcaggagaa caccgatcgc       780
     atcctcgcct tcctgcagca gcagccgctg gtcaagcgca tctatcaccc cagcctgccg       840
     agccatccgg gccatgatat tgcgcgccgt caacagtccg gtttcggcgc catgctaagt       900
     tttgagctcg attgcagcga ggcgggcatt cgcgccttcc tggcggctct caccctcttc       960
     tcggtggccg aatccctcgg cggggtggag agtctggtgg cccatccggc cagcatgacc      1020
     cacagggcca tgaccccggc cgcccagcag gcggcaggca tcagcagcca gctgctgcgt      1080
     ctgtcggtcg gtatcgaaca cggtgaggat ctggtggccg atctggccgc ggcgtttgca      1140
     caggcacagc aggtggcgaa gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page