(data stored in ACNUC7421 zone)

EMBL: CP000462.METJ

CP000462.METJ        Location/Qualifiers
FT   CDS_pept        complement(622158..622481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="AHA_0588"
FT                   /product="met repressor"
FT                   /note="identified by similarity to SP:P0A8U6; match to
FT                   protein family HMM PF01340"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38234"
FT                   /db_xref="GOA:A0KFU5"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFU5"
FT                   /protein_id="ABK38234.1"
FT                   /translation="MGTEWNGDYVSPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRR
FT                   QVNNLRHATNSELLCEAFLHAFTGQPLPCDEDLRKDHPDSVPAEARAIMEALGKEIEDF
FT                   DAE"
     atgggtacag agtggaacgg cgactacgtc agcccctacg cggaacacgg taagaagagc        60
     gaacaggtca agaagattac cgtctcgatc ccgctcaagg tgctgaaggt gttgaccgat       120
     gaacgcaccc gccgtcaggt gaacaacctg cgtcatgcga ccaacagcga gctgctctgc       180
     gaagccttcc tgcacgcctt caccggtcag ccgctgccct gcgacgaaga tctgcgcaag       240
     gatcatccgg acagcgtccc tgccgaggcg cgtgccatca tggaagcgct gggcaaagag       300
     atcgaagatt tcgacgccga gtaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page