(data stored in ACNUC7421 zone)

EMBL: CP000462.MGTA

CP000462.MGTA        Location/Qualifiers
FT   CDS_pept        260599..263367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtA"
FT                   /locus_tag="AHA_0238"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /EC_number="3.6.3.2"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00690; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01524"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39239"
FT                   /db_xref="GOA:A0KEV0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV0"
FT                   /protein_id="ABK39239.1"
FT                   /translation="MKQQHTASRHKQQGFVAPASAREKLSSRVLDEADKSLEYTLTAVR
FT                   GNIDGLTATEAANRLIQFGPNEVTHDKPPHALIQLLQAFKNPFVMVLIVLGLVSYVMDV
FT                   LMAEPGDEDWVKVTILGVMVGLSGLLRFWQEYRSAKAAEALKSLVRNTATVQRRPSPGV
FT                   APQRKEVAMTELVAGDIVHLQAGDMIPADIKLIESRDLFISQAVLTGEALPVEKYDTLG
FT                   AVAGKSADGTGTGAGEAGLLDLPNICFMGTNVVSGTARAVVVATGSDTYFGSLARNVVS
FT                   HKRIETSFDRGVNSVTKLLIRFMLVMVPIVFMLSGVSSGDWMSALTFALAVAVGLTPEM
FT                   LPMIVSANLARGAVAMAKRKVVVKRLNSVQNFGAMDVLCTDKTGTLTQDKIILEHHYDV
FT                   RGKRDDRILQLAWLNSFHQSGMKNLMDIAVVEHADALGESCKPANYRKVDELPFDFVRR
FT                   RLSVIVQDDLGQQLMVSKGAVEEMLAVSSQIADGQEVRELTDADRRALLRQSEEFNADG
FT                   YRVLIVATREIPATECKQSYRTSDEVKLVVRGFLTFFDPPKDSAAPAIRALNEYGVAVK
FT                   VLTGDNPIITSKVCRDVGLEPGVPLLGKDIEVMDDVALCTVVKHTTIFAKLTPLQKSRV
FT                   VKALQANGNTVGFLGDGINDAPALRDADVGISVDSGADIAKETADIILLEKSLMVLEEG
FT                   VIKGRETFGNILKYLNMTASSNFGNVFSVLVASAWLPWAPMLAMQMLIQNLVYDVSQML
FT                   LPWDKMDPEFLKRPRKWEASNIKRFMLWLGPTSSVFDISTYCLMWFVFGAGALYATANG
FT                   SMDPLVNGQAIMNSGWFIEGLVSQTLVVHMLRTRKIPFLQSTATLPVLLSTSIAIAIGC
FT                   YLPFSPLAEHFGFITLDGPKYFMWLVITMLAYMGLTQTVKSIYIKRHGQWF"
     atgaaacaac aacataccgc cagccggcac aagcagcagg ggttcgttgc cccggccagt        60
     gccagggaga aactctcctc ccgggtgctc gatgaggccg acaagtccct cgagtacacc       120
     ctcaccgccg tgcgcggcaa catcgacggc ctcaccgcga ccgaggccgc caaccgcctg       180
     atccagtttg gtcccaacga ggtgacccac gacaagccgc cccatgcgct gatccagctg       240
     ctgcaggcgt tcaagaaccc cttcgtgatg gtgctgatcg tgctcgggct ggtcagctac       300
     gtgatggacg tgctgatggc cgagccgggc gacgaggact gggtcaaggt gaccatcctc       360
     ggcgtcatgg tgggcctgag cggtctgctg cgcttctggc aggagtaccg ctctgccaag       420
     gcggccgaag cgctcaagtc gctggtgcgc aacaccgcta ccgtgcagcg ccgcccctcg       480
     cccggggtcg ccccccagcg caaggaggtg gccatgaccg agctggtggc cggtgacata       540
     gtgcacctgc aggcggggga catgatcccg gccgacatca agctgatcga atcccgcgat       600
     ctcttcatca gccaggcggt gctgaccggc gaagcgctgc cggtggagaa gtacgacacc       660
     ctgggcgccg tggccggcaa gtcggcggac ggcaccggca ccggcgcagg ggaggctggg       720
     ttgctcgatc tgcccaacat ctgcttcatg gggaccaacg tggtgagcgg taccgcccgc       780
     gccgtggtgg tggccaccgg cagcgacacc tatttcggtt cgctggcccg caacgtggtg       840
     agccacaagc gcatcgagac cagcttcgat cgcggtgtga acagcgtcac caagctgctt       900
     atccgcttca tgctggtgat ggtgcccatc gtcttcatgc tgagcggggt cagcagcggt       960
     gactggatgt cggcgctcac cttcgcactg gcggtggcgg tggggctcac ccccgagatg      1020
     ctgccgatga tcgtctccgc caacctggcg cgcggcgcgg tggccatggc caagcgcaag      1080
     gtggtggtga agcggctcaa ctcggtgcag aacttcggcg ccatggacgt gctctgcacc      1140
     gacaagaccg gcaccctgac ccaggacaag atcatcctcg agcaccacta cgacgtgcgt      1200
     ggcaagcggg acgaccggat cctgcagctg gcctggctca acagctttca ccagagcggc      1260
     atgaagaacc tgatggacat cgcggtggtc gagcacgccg atgcgctggg ggagagctgc      1320
     aagccggcca actaccgcaa ggtggacgag ctgccgttcg acttcgtgcg ccggcgcctg      1380
     tcggtgatcg tgcaggatga tctgggccag cagctgatgg tctccaaggg ggcggtggaa      1440
     gagatgctgg ccgtctccag ccagatcgcc gatggccagg aggttaggga gctgaccgac      1500
     gcggatcgcc gcgccctgct gcgccagagc gaggagttca acgccgacgg ttatcgggtg      1560
     ctgatcgtgg cgacccgcga gatcccggct accgagtgca agcagagcta tcgcaccagc      1620
     gacgaggtca agctggtggt gcgcggcttc ctcaccttct tcgatccgcc caaggattcg      1680
     gccgcgccgg ccattcgcgc cctcaatgag tacggcgtag cggtcaaggt gctgaccggc      1740
     gacaacccca tcatcaccag caaggtgtgt cgcgatgtgg ggctggagcc cggcgtgccg      1800
     ctgcttggca aggatatcga ggtgatggac gacgtggcgc tgtgcaccgt ggtcaaacac      1860
     accaccatct ttgccaagct caccccgctg cagaagtcgc gggtggtgaa ggcgctgcag      1920
     gccaacggca acacagtggg tttcctcggt gacggcatca acgatgcgcc ggcgctgcgg      1980
     gatgcggacg tgggtatctc ggtggacagc ggtgccgaca tcgccaagga gaccgccgac      2040
     atcatcctgc tggagaagag cctgatggta ctggaagaag gggtgatcaa ggggcgcgag      2100
     acctttggca acatcttgaa gtacctcaac atgaccgcca gctccaactt cggcaacgtc      2160
     ttctcggtgc tggtggcttc cgcctggctg ccctgggcgc ccatgctggc gatgcagatg      2220
     ctgatccaga acctggtgta tgacgtctcc cagatgctgc tgccgtggga caagatggac      2280
     cccgagttcc tcaagcggcc gcgcaagtgg gaggcgagca acatcaagcg cttcatgctg      2340
     tggctcggcc cgacttcgtc ggtgttcgat atcagcacct actgcctgat gtggttcgtg      2400
     ttcggtgccg gtgccctcta tgccaccgcc aacggcagca tggatccgct ggtcaacggt      2460
     caggccatca tgaactcagg ctggttcatc gaggggctgg tgtcgcagac cctggtggtg      2520
     cacatgttgc gtacccgcaa gatccccttc ctgcagagta ccgccactct gccggtgctg      2580
     ctctccacct cgatcgccat cgccatcggc tgctacctgc cgttctcgcc gctggccgag      2640
     cacttcggct tcatcactct ggatgggccc aagtacttca tgtggctggt gatcaccatg      2700
     ctggcctaca tggggctgac ccagaccgtc aagagcatct acatcaagcg ccacggccag      2760
     tggttctga                                                              2769
//

If you have problems or comments...

PBIL Back to PBIL home page