(data stored in ACNUC7421 zone)

EMBL: CP000462.MMSA-1

CP000462.MMSA-1      Location/Qualifiers
FT   CDS_pept        270323..271819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA-1"
FT                   /locus_tag="AHA_0246"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38787"
FT                   /db_xref="GOA:A0KEV8"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV8"
FT                   /protein_id="ABK38787.1"
FT                   /translation="MTYRVSNFIDGETTESRSERFGAIFNPATGQQQGQVVLSTAAECQ
FT                   DAIASAERALADWAQTPPLVRARVLFRFKELMEQHRDDLARLISREHGKVFSDAQGELT
FT                   RGLEVVEFACGIPHLLKGEHSLNVGRGVDSHSMMQPVGVCAGITPFNFPAMVPLWMFPV
FT                   AIACGNTFILKPSEKDPSLSLRMAELLKQAGLPDGVLNVVNGDKEVVDVLLTDPRVGAV
FT                   SFVGSTPIAQYIYATASAHGKRVQALGGAKNHMLVMPDADLELAVSALMGAAYGAAGER
FT                   CMAISVAVVVGDETADALVARLSPLVAALRVGPGLGQSPENEMGPLISREHLAKVRGYV
FT                   DQGVAEGAELVVDGRGLSHGEGYFIGGSLFDRVGPEMRIYREEIFGPVLAIVRAPDYET
FT                   ALRLINEHEYGNGTAIFTCDGDTARDFTARVQVGMVGVNVPIPVPMAFHSFGGWKRSIF
FT                   GPLNMHGPDGVRFYTRMKTVTARWPQSLRAGAEFSMPTMK"
     atgacataca gggtcagcaa cttcatcgac ggcgagacga ccgagagccg cagcgagcgc        60
     ttcggagcca tcttcaaccc ggccaccggc cagcagcagg gtcaggtggt gctcagcacc       120
     gccgccgagt gccaggatgc catcgccagc gccgagcgcg ccctggctga ctgggcgcag       180
     actccgccgc tggtgcgagc ccgggtgctg tttcgcttca aggagttgat ggagcagcac       240
     agggacgatc tggcgcggct gatcagtcgc gagcacggca aggtgttctc cgacgcccag       300
     ggcgagctga ctcgtggcct cgaggtggtg gagtttgcct gcggcattcc ccacctgctc       360
     aagggggagc actccctcaa cgtggggcgc ggggtcgaca gccactccat gatgcagccg       420
     gtgggtgtct gcgccggcat caccccgttc aacttcccgg ccatggtgcc gctgtggatg       480
     ttcccggtgg ccatcgcctg cggcaacacc ttcattctca agccctccga gaaggatccc       540
     tccctctccc tgcgcatggc cgagctgctc aagcaggccg gcctgccgga cggggtgctc       600
     aacgtggtca acggtgacaa ggaggtggta gacgtgctgc tgaccgaccc gcgggtcggt       660
     gccgtgtcgt ttgtcggctc cacccccatc gcccagtaca tctatgccac cgcctcggcc       720
     cacggcaagc gggtgcaggc gctgggcggc gccaagaacc acatgctggt gatgccggat       780
     gctgatctcg aactggcggt ctccgccctg atgggagcgg cctacggtgc ggccggcgag       840
     cgctgcatgg ccatttcggt ggccgtggtg gtgggggacg agacggccga tgcgctggtg       900
     gccaggttgt cgccgctggt ggcggcgctg cgggtgggcc cggggctggg ccagagcccg       960
     gagaacgaga tggggccgct catcagccgc gagcacctgg ccaaggtgcg cggctatgtg      1020
     gatcaggggg tggccgaggg agccgagctg gtggtggacg gtcggggcct gagccacggc      1080
     gagggttact tcatcggcgg cagcctgttc gaccgggtcg gccccgagat gcgcatctac      1140
     cgggaggaga tcttcggccc tgtgcttgcc atcgtgcggg cgccagacta cgagacggcg      1200
     ctcaggctca tcaacgaaca cgagtacggc aacggcaccg ccatcttcac ctgtgacggc      1260
     gacaccgcgc gggacttcac cgcccgcgtg caggtcggta tggtaggggt gaacgttccc      1320
     atcccggtgc ccatggcgtt tcacagcttt ggtggctgga agcggtccat cttcgggccg      1380
     ctcaacatgc acgggccgga tggggtgcgc ttctataccc ggatgaagac ggtgactgcc      1440
     cgctggcccc agagcctgcg ggcgggcgcg gagttctcca tgccgaccat gaagtaa         1497
//

If you have problems or comments...

PBIL Back to PBIL home page