(data stored in ACNUC7421 zone)

EMBL: CP000462.MURI

CP000462.MURI        Location/Qualifiers
FT   CDS_pept        83265..84059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="AHA_0075"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00067"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39043"
FT                   /db_xref="GOA:A0KEF2"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEF2"
FT                   /protein_id="ABK39043.1"
FT                   /translation="MANILVFDSGMGGLTIYREIRRALPAHNYFYCFDNANFPYGELSE
FT                   AALTEVCTRLVSHMVVEHDIDLVVIACNTASTIALPSLRAAMTVPVVGVVPAIKPAAAL
FT                   TRNGCIGLLATPGTVSREYTHELIAQFAPGKRVLLKGATELVVEAEHKLAGLPVNMALL
FT                   REVLADWLEGEEHPDTLVLGCTHFPLLDEEIRQLMPACQLVDSGSAVAKRVAHLLAGLV
FT                   TTPTRLEDVGGKAYCTRLDAQTQKLTAPLQAWGLSSLEEVRF"
     gtggccaata ttctcgtgtt cgactccggt atgggtggcc tgaccatcta ccgcgagatc        60
     cgccgcgcat tgccggcaca caactacttc tattgttttg ataatgccaa cttcccctat       120
     ggtgagctga gcgaggccgc cctcaccgaa gtctgcacca ggttggtcag ccacatggtg       180
     gtcgagcatg atatcgatct ggtggtgatt gcctgcaaca cggccagcac catcgctctg       240
     ccgtccctgc gtgctgccat gacagtaccg gtcgttggcg tggtacccgc catcaagccc       300
     gcagccgcgc ttacccgtaa tggttgcatc ggcttgctgg caaccccggg taccgtcagc       360
     cgtgaatata cccacgagct catcgcccag tttgcgccgg gcaagcgggt cttgctcaag       420
     ggggcgaccg agctggtcgt cgaggccgag cacaagctgg cgggtctgcc ggtcaatatg       480
     gcgctgttgc gggaagtatt ggcagactgg ctggaagggg aagagcatcc ggataccctg       540
     gtgctgggct gtacccattt ccccttgctg gatgaagaga tacggcagct gatgcctgcg       600
     tgccagctgg tggattccgg cagtgcggtc gccaagcggg tggctcacct gctggccggt       660
     ttggtaacga caccgacacg gctggaagat gtcgggggta aggcctattg cacccggctg       720
     gatgcccaga cccagaaact gacagccccc ttgcaagctt gggggctgtc atcactcgaa       780
     gaggtcaggt tctaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page