(data stored in ACNUC7421 zone)

EMBL: CP000462.MUTM

CP000462.MUTM        Location/Qualifiers
FT   CDS_pept        182978..183790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="AHA_0164"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38933"
FT                   /db_xref="GOA:A0KEN2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEN2"
FT                   /protein_id="ABK38933.1"
FT                   /translation="MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELV
FT                   DLTIHRVSRRAKYLLLETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLR
FT                   LNDPRRFGALLWTREPAEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQ
FT                   VVVGVGNIYANEALYAAGIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFT
FT                   SADGKPGYFVQQLQVYGRGGQPCFHCHTLLSEIRLGQRTTVFCSHCQR"
     atgcctgaat taccggaagt cgaagtcagc cgccagggta tctcgccctg gcttaccggc        60
     atcaaggtca cccgagtggt ggtgcgggac ggccgcctgc gctggccggt gccgggggaa       120
     atccaggagc tggtggatct caccatccac cgggtcagcc gccgcgccaa gtacctgctg       180
     ctggagaccg acttcggcac cgccatcctc catctgggca tgtcgggcag cctgcgggtg       240
     ctggacatcg gcaccccggc cgagaagcac gatcacgtgg atatcgagct ggccaacggc       300
     aagctgctgc ggctcaacga tccgcgccgc ttcggcgccc tgctgtggac ccgcgagccg       360
     gccgaggcgc acgcgctgct ggccaagctg gggccggagc cgctcaccga tgcgttcaat       420
     gctgattacc tgcgtgagcg cgccaagggg cgcagcaccg ccatcaagac cttcctgatg       480
     gacaaccagg tggtggtcgg ggtgggcaat atctacgcca acgaggcgct ctacgccgcc       540
     ggcattcacc ccaagcgggc ggcgggcaac atcagcgccg agcgcttggg caccctggtg       600
     gccgagatca agcgggtgct ggccgaagcg attcggcagg gcggcaccac cctcaaggat       660
     ttcaccagtg cagacggcaa gccgggctat ttcgtgcagc agctgcaggt gtacgggcgg       720
     ggcggccagc cctgttttca ctgccacacc ctgctcagtg aaatccggct gggacagcgt       780
     accaccgtgt tctgttccca ctgccagcgc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page