(data stored in ACNUC7421 zone)

EMBL: CP000462.NTRC

CP000462.NTRC        Location/Qualifiers
FT   CDS_pept        complement(297254..298672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="AHA_0274"
FT                   /product="nitrogen regulation protein NR(I)"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954; match to protein family HMM TIGR01818"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37436"
FT                   /db_xref="GOA:A0KEY6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY6"
FT                   /protein_id="ABK37436.1"
FT                   /translation="MTAKVWIVDDDSSIRWVLERTLGSEGFECESFADGEALLSSLEMR
FT                   SPDVILSDIRMPGIDGLSLLEQIHRRQADLPIIIMTAHSDLDSAVNAYQRGAFEYLPKP
FT                   FDIDEAVTLVRRAENHLKEQRTKRKARQQDPASSPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAHALHKHSPRAHKNFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   NIRHGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHQPVQVDVRIIAAT
FT                   HQNLEKRVADGEFREDLFHRLNVIRIHIPALKERREDIPQLAQHFLLRAAKELNVEAKS
FT                   LHPDTQAYISRLPWPGNVRQLENVCRWLTVMASGQEVLVSDLPTELLTPITSTAEPGQP
FT                   ALSGGWQQQLQDWVAAKLALGETDILADALPQFERIMLETALDHTHGHKQEAARLLGWG
FT                   RNTLTRKLKELDLS"
     atgacagcaa aagtgtggat cgtcgatgac gacagttcta tccgctgggt gctggagcgc        60
     accctcggca gtgaaggttt cgagtgcgag agcttcgccg atggcgaggc gctgctgagc       120
     tcgctggaaa tgcgctcacc ggacgtgatc ctctccgata tccgcatgcc cggcatcgac       180
     ggcctcagcc tgctggagca gatccatcgc cgccaggccg atctgcccat catcatcatg       240
     accgcccact cggatctcga cagcgcggtc aatgcctacc agcgcggcgc cttcgaatac       300
     ctgcccaagc cgttcgatat cgacgaggcg gtcaccctgg tgcgccgcgc cgagaatcac       360
     ctcaaggagc aacgcaccaa acgcaaggct cgccagcagg atccggccag cagcccggag       420
     atcatcggcg aggcaccggc gatgcaggag gtgttccgcg ccatcggccg gctgtcgcgc       480
     tccagcatct cggtgctgat caacggccag agcggcaccg gcaaggagct ggtcgcccac       540
     gccctgcaca agcacagccc gcgcgcccac aagaacttca tcgccctcaa catggccgcc       600
     atcccgaaag atctcatcga atcggaactg ttcggccatg agaaaggggc cttcaccggc       660
     gccaacaaca ttcgccacgg ccgcttcgaa caggccgacg gcggcaccct gtttctcgac       720
     gagatcggcg acatgccgct agatgtgcag acccgactgc tgcgggtact ggccgacggc       780
     cagttctacc gggttggcgg ccatcagccg gtgcaggtgg atgtgcggat catcgccgcc       840
     acccaccaga atctggagaa gcgagtggca gacggcgagt ttcgggaaga cctgttccac       900
     cgcctcaatg tcatccggat ccacattccc gccctcaagg agcggcgtga ggacattccc       960
     caactggccc agcacttcct gctgcgggcg gccaaggagc tgaacgtgga ggccaagagc      1020
     ctgcatccgg atacccaggc ctacatcagc cgcctgccct ggccgggcaa cgtgcgccag      1080
     ctggagaacg tctgccgctg gcttaccgtg atggcttcgg gccaggaggt gctggtgagc      1140
     gatctgccca ccgagctgct cacccccatc accagcaccg ccgaaccggg tcagccggcc      1200
     ctgtctggcg gctggcagca gcagttgcag gattgggtcg ccgccaagct ggcgctgggg      1260
     gagaccgaca tactggccga tgccctgccc cagttcgagc ggatcatgct ggaaaccgca      1320
     cttgaccaca cccatggtca caagcaggag gcggcacggc tgctcggttg ggggcgcaac      1380
     accctcaccc gcaagctgaa agaactcgac ctctcctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page