(data stored in ACNUC7421 zone)

EMBL: CP000462.PCKA

CP000462.PCKA        Location/Qualifiers
FT   CDS_pept        complement(599480..601105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="AHA_0565"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="identified by match to protein family HMM PF01293;
FT                   match to protein family HMM TIGR00224"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38879"
FT                   /db_xref="GOA:A0KFS2"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:A0KFS2"
FT                   /protein_id="ABK38879.1"
FT                   /translation="MTIVAEPTLAKQLGLDQYGIKNSTEILRNPSYDQLFAEETRADLE
FT                   GFERGVVTELGAVNVNTGIFTGRSPKDKYIVKDATTQNTVWWSDQGKNDNKAISPEVWS
FT                   HLKSLVTKQLSGKRLFVVDGFCGANPDTRLAVRIITEVAWQAHFVKNMFIRPSDEELKT
FT                   FKPDFVVMNGAKCTNPNWKEQGLNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFSMMNY
FT                   FLPLRGIASMHCSANVGQDGDVAIFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFN
FT                   FEGGCYAKTIKLSKEAEPDIYNAIRRDALLENVTVAADGTIDFDDGSKTENTRVSYPIY
FT                   HIENIVKPVSKAGHANKVIFLTADAFGVLPPVSKLTKEQTKYHFLSGFTAKLAGTERGI
FT                   TEPTPTFSSCFGAAFLSLHPTKYGQELVKRMEAAGAEAYLVNTGWNGTGKRISIKDTRA
FT                   IIDAILDGSIEKAETKVLPIFNLEVPTALHDVNPAILDPRDTYANKAEWDAKAVDLAGR
FT                   FIKNFERFTDNEEGKRLVAAGPQL"
     atgacaatcg tggcagaacc caccctggcc aagcaattag gactggacca gtacggtatc        60
     aagaactcca ctgaaatcct gcgcaaccct tcctacgacc agctgttcgc ggaagagaca       120
     cgtgccgacc tggaagggtt cgagcgcggc gtggtgaccg aactgggcgc cgtcaatgtc       180
     aataccggca tcttcaccgg ccgctcccct aaagataaat atatcgtcaa agacgccact       240
     acccagaata ctgtgtggtg gtctgaccag ggtaaaaacg ataacaaagc catcagcccg       300
     gaagtgtggt cacatctgaa atccctggtg accaaacagc tctccggcaa gcgcctgttc       360
     gtggtcgacg gcttctgcgg tgccaacccg gacacccgcc tggccgtgcg catcatcacc       420
     gaggtggcct ggcaggctca cttcgtgaaa aacatgttca ttcgcccgag cgatgaagag       480
     ctgaaaacct tcaaaccgga cttcgtggtg atgaacggtg ccaagtgcac caacccgaac       540
     tggaaggagc agggtctcaa ctccgagaac ttcgtcgcct tcaacctgac cgagaagatc       600
     cagctcatcg gcggcacctg gtacggtggc gagatgaaga aggggatgtt ctccatgatg       660
     aactacttcc tgcccctgcg cggcatcgcc tccatgcact gctccgccaa cgtgggtcag       720
     gacggtgacg tggccatctt cttcggcctg tccggtaccg gcaagaccac cctctccacc       780
     gatcccaagc gtcagctgat cggcgatgac gagcacggct gggacgacga cggcgtgttc       840
     aacttcgaag gcggctgcta cgccaagacc atcaagctct ccaaggaagc cgagccggac       900
     atctacaacg ccatccgtcg cgatgcgctg ctggagaacg tgaccgtggc ggccgacggc       960
     accatcgact tcgacgatgg ctccaagacc gagaacaccc gggtctccta ccccatctat      1020
     cacatcgaga acatcgtcaa gccggtctcc aaggcgggtc acgccaacaa ggtgatcttc      1080
     ctgaccgccg atgccttcgg cgtgctgccc ccggtctcca agctgaccaa ggagcagacc      1140
     aagtaccact tcctgtctgg cttcaccgcc aaactggccg gtaccgagcg cggcatcaca      1200
     gagccgaccc cgaccttctc ctcctgcttc ggcgcagcct tcctctccct gcacccgacc      1260
     aagtacggtc aggagctggt gaaacggatg gaagccgccg gcgcggaagc ctacttggtc      1320
     aacaccggct ggaacggcac cggcaagcgc atctccatca aggatacccg cgccatcatc      1380
     gacgccatcc tggatggctc catcgagaag gccgagacca aggtgctgcc gatcttcaat      1440
     ctggaagtgc cgaccgccct gcacgacgtg aacccggcaa tcctcgaccc gcgcgacact      1500
     tacgccaaca aggccgagtg ggatgccaag gcggttgacc tggcaggacg ctttatcaag      1560
     aacttcgagc gcttcaccga caatgaagag ggcaagcgtc tggtagcggc aggcccgcag      1620
     ctgtaa                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page