(data stored in ACNUC7421 zone)

EMBL: CP000462.PE100

CP000462.PE100       Location/Qualifiers
FT   CDS_pept        complement(120746..121447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0109"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein LivF"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38514"
FT                   /db_xref="GOA:A0KEI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI1"
FT                   /protein_id="ABK38514.1"
FT                   /translation="MLELRNVSTHYGKIQALHDVSVQVKEGEIVTLIGANGAGKTTLLM
FT                   TLCGEPKPSSGSIWFEGEQIDSLSTARIMRKDIAVVPEGRRIFARLTVEENLLMGAFFV
FT                   DKAEQRGLLDQIFTLFPRLHERLEQRAGTMSGGEQQMLAIGRALMSKPRLLLLDEPSLG
FT                   LAPIVIQQIFDTIEQLRRDGMTIFLVEQNANQALKLADRGYVLENGHVVLQDTGAALLA
FT                   NPAVRQAYLGG"
     atgttagaac ttcgcaacgt atcgacccac tacggcaaaa ttcaggcgct gcacgacgtc        60
     agcgtccagg taaaagaggg ggaaatcgtc accctgatcg gtgccaacgg cgccggcaag       120
     accaccttgc tgatgaccct gtgcggcgaa cccaagccca gcagtggctc catctggttc       180
     gagggagagc agatagactc gctctccacc gcccgcatca tgcgcaagga catcgccgtg       240
     gtgccggagg ggcgccgcat cttcgctcgc ctgacggtgg aggagaacct gctgatgggg       300
     gccttcttcg tcgacaaggc cgagcagcgc ggcctgctgg atcagatttt caccctgttc       360
     ccccgcctgc acgagcgcct ggagcagcgc gccggcacca tgtccggcgg cgagcagcag       420
     atgctggcca tcggccgcgc cctgatgagc aagccgcgcc tgctgctgct ggatgaaccc       480
     tcgctggggc tggcccccat cgtcatccag cagatcttcg acaccataga gcagctgcgc       540
     cgcgacggca tgaccatctt cctggtggag cagaacgcca accaggcgct caagctggcc       600
     gatcgcggct atgtgctgga gaacggccac gtggtactgc aggacacggg ggctgccctg       660
     ttggccaacc cggccgtccg ccaggcttat ctcggcggct ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page