(data stored in ACNUC7421 zone)

EMBL: CP000462.PE101

CP000462.PE101       Location/Qualifiers
FT   CDS_pept        complement(121458..122231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0110"
FT                   /product="high-affinity branched-chain amino acid ABC
FT                   transporter, ATP-binding protein LivG"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37976"
FT                   /db_xref="GOA:A0KEI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI2"
FT                   /protein_id="ABK37976.1"
FT                   /translation="MSANQKLMEVSDLSMRFGGLLAVNGVKLDVDKGEVISIIGPNGAG
FT                   KTTVFNCLTGFYRPSGGIIRYKGEEIQGLPGHLIARKGIVRTFQHVRLFKDMTAVENLL
FT                   VAQHRHLNTGFLAGLFKTPAFRRAEREGLEQSAFWLEKVGLKDLANRAAGNLAYGQQRR
FT                   LEIARCMATRPELLMLDEPAAGLNPHETDELNELISNLRDEFGVSVLLIEHDMKLVMEI
FT                   SNRIFVVNQGTPLAHGKPDEIRSNPAVIKAYLGES"
     atgagtgcaa atcagaagtt aatggaagtc tctgatctgt cgatgcgctt cggagggttg        60
     ctggccgtca acggcgtcaa gctggacgtg gacaaggggg aggtgatctc catcataggc       120
     cccaacgggg cgggcaagac caccgtcttc aactgcctga ccggcttcta ccgcccgagc       180
     ggcggcatca tccgctacaa gggtgaggag atccaggggc tgcccggcca cctcatcgcc       240
     cgcaagggga tagtgcgcac ctttcagcac gtgcgactgt tcaaggacat gacagcggtg       300
     gaaaacctgc tggtggccca gcacaggcac ctcaacaccg gctttctggc cgggctgttc       360
     aagaccccgg cctttcgccg cgccgagcgg gaggggctgg agcagtccgc cttctggctg       420
     gagaaggtgg ggctcaagga tctcgccaac cgcgccgccg gcaacctggc ctatggccag       480
     cagcgccggc tcgagattgc ccgctgcatg gcgacccggc ccgagctgct gatgctggac       540
     gagccggccg ccggcctcaa cccccacgag accgatgagc tgaacgagct catctccaac       600
     ctgcgggacg agttcggggt ctcggtgctg ctgatcgaac acgacatgaa gctggtgatg       660
     gagatctcca accgcatctt cgtggtcaac cagggcaccc cgctggccca cggcaagccg       720
     gacgagatcc gcagcaatcc ggcagtgatc aaggcctatc tgggcgagtc gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page