(data stored in ACNUC7421 zone)

EMBL: CP000462.PE103

CP000462.PE103       Location/Qualifiers
FT   CDS_pept        complement(123496..124422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0112"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system permeaseprotein LivH"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36338"
FT                   /db_xref="GOA:A0KEI4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI4"
FT                   /protein_id="ABK36338.1"
FT                   /translation="MSEHFLYLVQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYVAFMVMAGLMMMGIDSTFLLLGGAFLVSIVITGTYGWTIERVAYRPLRGGNR
FT                   LIPLISAIGMSIFLQNMMRMAQGSRDIAMPTLISGGWTLGEADGFQASLSWMQLIIFVV
FT                   TFITMLALTQFIGRSRMGRACRACSEDIKMANLLGIDTHVVISITFVLGATLAAVAGVL
FT                   LGMYYGVINPYLGFMAGLKAFTAAVLGGIGSIPGAVLGGLLLGVVEALTAGYLSTEYKD
FT                   VMAFALLIGVLLFMPTGILGRPEVEKV"
     atgtccgaac acttccttta cctggttcag cagttgctga acgggttaac cataggcagc        60
     acctatgcgt tgatcgccat cggctacacc atggtctatg gcatcatcgg catgatcaac       120
     ttcgcccacg gcgaggtcta catgatcggc tcctatgtcg ctttcatggt gatggcgggg       180
     ctcatgatga tgggcatcga cagcaccttc ttgctgctgg ggggcgcctt cctggtcagc       240
     atcgtcatca ccggcaccta tggctggacc atagagcggg tcgcctaccg cccactgcgg       300
     ggcggcaacc ggctgatccc cctcatctcc gccatcggca tgtcgatctt cctgcagaac       360
     atgatgcgga tggcccaggg ctcgcgcgac atcgccatgc ccaccctgat ctccggcggc       420
     tggaccctgg gtgaagccga cggcttccag gccagcctct cctggatgca gctcatcatc       480
     ttcgtggtca ccttcatcac catgctggca ctgacccagt tcatcggtcg ctcccgcatg       540
     ggccgcgcct gccgcgcctg ttcggaagac atcaagatgg ccaacctgct ggggatagac       600
     acccacgtgg tcatctccat caccttcgtg ctgggggcca ccctggccgc cgtcgccggc       660
     gtgctgctcg gcatgtatta cggcgtcatc aacccctacc tcggcttcat ggccgggctg       720
     aaagccttca ctgcggcggt gctgggcggt atcggcagca ttcccggcgc cgtgctgggc       780
     ggcctgctgc tcggcgtggt cgaggcgctc accgccggct acctcagcac cgagtacaag       840
     gatgtgatgg cctttgccct gctgatcggc gtgctgctgt tcatgcccac cggcattctg       900
     ggtcgcccgg aggtcgagaa ggtatga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page