(data stored in ACNUC7421 zone)

EMBL: CP000462.PE104

CP000462.PE104       Location/Qualifiers
FT   CDS_pept        complement(124487..125590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0113"
FT                   /product="Leu/Ile/Val-binding protein"
FT                   /note="identified by match to protein family HMM PF01094"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38195"
FT                   /db_xref="GOA:A0KEI5"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEI5"
FT                   /protein_id="ABK38195.1"
FT                   /translation="MAVRTAVSMALFGSVSLVHAADTIKIGIAGPVTGPVAQYGDMQFT
FT                   GGKMAVEQINKAGGIKGKQIEAVIYDDACDPKQAVAVANKVINDGVKFVVGHLCSDNTL
FT                   PASDIYEDEGVLMVTPASTNPKITERGYQLVLRTIGLDSDQGPTAAKYIIEQVKPKRVA
FT                   VIHDKKQYGEGIASSVKAALDKAGVKVVAFEGITAGDKDFSALIAKLQKENVDFVYYGG
FT                   YHPELGLILRQAGEKGLKAKFMGPEGVGNKDISAIGGPASEGLLVTLPNKYDLVPANAP
FT                   LVAAFKAKGQDSSGPFVWTTYAAVQTLAAGIAKAGEDDPAAVAAAIKAAPIDTVMGTLS
FT                   WAPSGDLKGFEFGVFQWHADGTSTQVK"
     atggcagtca ggacagcggt ttctatggcc ctgttcggat cggtatcact ggtccacgcg        60
     gcggacacaa tcaagatcgg catcgccggt ccggtcaccg gcccggtcgc ccagtacggc       120
     gacatgcagt tcaccggcgg caagatggca gtcgagcaga tcaacaaggc cggtggcatc       180
     aagggcaagc agatcgaagc cgtcatctat gacgacgcct gcgatcccaa gcaggccgtg       240
     gcggtcgcca acaaggtgat caacgacggc gtcaagttcg tggtcggcca cctttgctcc       300
     gacaacaccc tgcccgcttc cgacatctat gaagatgaag gcgtgctgat ggtcactccg       360
     gcctccacca accccaagat caccgagcgc ggctatcagt tggtgctgcg taccatcggc       420
     ctggacagcg accagggtcc gactgccgcc aagtacatca tcgagcaggt caagcccaag       480
     cgcgtggccg tcattcacga caagaaacag tacggcgaag gcatcgcctc cagcgtgaaa       540
     gcggcgctgg acaaggccgg cgtcaaggtg gtggcgtttg aaggcatcac cgccggcgac       600
     aaggacttct ctgccctgat cgccaagctg caaaaagaga acgtcgactt cgtctactac       660
     ggtggttatc accccgagct gggtctgatc ctgcgtcagg ctggcgagaa gggcctcaag       720
     gccaagttca tgggtccgga aggggtcggc aacaaggaca tctccgccat cggcggccca       780
     gcctccgaag gcctgctggt gaccctgccg aacaaatatg atctggtgcc ggccaacgcc       840
     ccgctggtgg ctgcgttcaa ggccaagggc caggactcct ccggtccgtt cgtgtggacc       900
     acctatgccg cggtgcaaac cctggctgcc ggtatcgcca aggcgggtga ggatgacccg       960
     gctgccgttg ctgccgccat caaggccgca ccgatcgata ccgtcatggg caccctgagc      1020
     tgggctccga gtggcgacct gaaaggcttt gaattcggtg tgttccagtg gcacgccgac      1080
     ggtacctcca ctcaagtcaa ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page