(data stored in ACNUC7421 zone)

EMBL: CP000462.PE11

CP000462.PE11        Location/Qualifiers
FT   CDS_pept        complement(10506..11330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0010"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38946"
FT                   /db_xref="GOA:A0KEB0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEB0"
FT                   /protein_id="ABK38946.1"
FT                   /translation="MAFILPDHPFDPDQHDGSAIGIASALGWHDSGRHQHKRHQLLFAQ
FT                   AGCMTIELDDQVCLLPPTRAAWLPAGLPHRVLMRGVVAYRSLYFQPEPGLPTEMAVLAV
FT                   NPLLREIIERMAIWPWDKPAAEQHCTLALLQEELAQAPRESWQLPLPSDPRLAGWLQEV
FT                   KRGDTLPDRLNRLAERVGASDKTIGRIFMRETGMSYQAWRQQWRLLRALELLAEAEPIS
FT                   RVAATLEFASDSAFISFFRQHTGQTPLRYLNSRGESHRPSSPPPPGSPAPAA"
     atggctttta ttcttcccga tcaccctttt gacccggatc agcacgatgg cagcgccatc        60
     gggattgcct ccgccctcgg ctggcacgac tccggtcgcc atcagcacaa gcgtcatcag       120
     ctgctgttcg cccaggccgg ctgcatgacc atagagctgg acgatcaggt ctgcctgctg       180
     ccgccgacac gggcggcctg gctgccggca ggcctgcccc atcgggtgct gatgcgcgga       240
     gtggtggcgt atcgctccct ctacttccag ccggagcccg gcttgccgac cgagatggcg       300
     gtgctggcgg tcaacccgct gctgcgggag atcatcgagc ggatggcgat ctggccgtgg       360
     gacaaaccgg cagcggagca acattgcacg ctggcgctgt tgcaggaaga gctggcgcaa       420
     gcgccgcggg aatcctggca gttgccgctg ccgtcagacc cacgtctggc cggctggctg       480
     caggaagtga agcggggcga caccctgccc gatcggctca accggctggc cgaacgggtg       540
     ggtgccagtg acaagaccat aggtcgtatc ttcatgcggg agaccggcat gagctaccag       600
     gcctggcgcc agcagtggcg actgttgcgg gcgctggagc tgctggccga ggccgaaccc       660
     atcagccggg tggcggcaac gctggagttc gccagcgaca gcgccttcat cagcttcttc       720
     agacagcaca cggggcagac cccgctgcgc tatctcaact ctcggggtga gtcgcatcgg       780
     ccgagctcgc ctccaccacc agggtctcca gcgccagcgg cttga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page