(data stored in ACNUC7421 zone)

EMBL: CP000462.PE114

CP000462.PE114       Location/Qualifiers
FT   CDS_pept        137466..138692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0123"
FT                   /product="Low affinity tryptophan permease"
FT                   /note="identified by match to protein family HMM PF03222;
FT                   match to protein family HMM TIGR00837"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39280"
FT                   /db_xref="GOA:A0KEJ5"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ5"
FT                   /protein_id="ABK39280.1"
FT                   /translation="MGQKPSLVGGACIIAGVCVGAGMLGLPSAGAGAWTIWSVLAITLT
FT                   MIVMTLSGWMLLESYQGYPLRVSFDTVTRELLGEKLNALNNLTVYFVGGILLYAYITSA
FT                   GLIIDGMTGIGSQWGSVLFTLGFSGLVWHSTRAVDRISVVLVIAMGLSFVFGISGLSLN
FT                   IKPTLLFDTLSEHASYAPYALAMLPVALTSFGYHHSVSSMRAYYGEERRARYAILGGTA
FT                   IALLFYLIWLVSVFGNLPRSEFGPVVAQGGNVDVLLKALASVIESEAVASALNLFSMAA
FT                   ILSSFIGVGLGVFDYLADLFKFDNGRGGRAKSWAATFLPPLLLSLLFPFGFLMAIGYAG
FT                   AVATLWTCIIPALLAWKVRAGKGKQGDKQGGFRAPGGMPMIAGVFLFGVLTAAFHLLNM
FT                   AGLLPVYTG"
     atgggacaga aaccatcgtt ggtgggcggg gcatgcatca ttgccggcgt ctgtgtaggg        60
     gccggcatgc tgggcttgcc gagtgcgggg gcgggcgcct ggaccatctg gtcggtgctg       120
     gccatcaccc tgaccatgat cgtgatgacg ctctctggct ggatgctgct ggagtcctat       180
     cagggctatc cgctgcgcgt gtcgttcgat accgttaccc gcgaactgct gggggagaag       240
     ctcaacgccc tcaacaacct caccgtctat ttcgtcggcg gcatcctgct ctacgcctac       300
     atcacctcgg ccggcctcat catcgacggc atgaccggca tcggcagcca gtggggctca       360
     gtcctgttta ccctgggctt ctccggtctg gtgtggcact ccacccgggc ggtggatcgc       420
     atctccgtgg tgctggtcat cgccatgggg ctgagcttcg tgttcggcat ctctgggttg       480
     tcgctcaaca tcaaaccgac cctgctgttc gacaccctga gcgagcacgc cagctatgcc       540
     ccctatgcgc tggccatgct gccggtggcg ctcacctcgt tcggttatca ccactcggtg       600
     tcgtccatgc gcgcctacta cggtgaggag cgccgcgccc gttacgccat cctcggcggc       660
     accgccatcg cgctgctgtt ctacctcatc tggctggtga gcgtgttcgg caacctgccg       720
     cgcagtgagt tcggccctgt ggtagcgcag ggtggcaacg tcgacgtgct gctcaaggcg       780
     ctggcctcgg tgatcgaatc cgaggcggtc gccagcgccc tcaacctctt ctccatggct       840
     gccatcctct cctccttcat cggggtaggg ctgggggtgt tcgactatct ggcggatctg       900
     ttcaagttcg acaacggccg tggcggccgt gccaagtcgt gggcagccac cttcctgccg       960
     ccgttgctgc tctccctgct gttcccgttc ggcttcctga tggccatcgg ctacgcgggc      1020
     gccgtggcca ccctgtggac ctgcatcatc ccggccctgc tggcctggaa ggtgcgcgcc      1080
     ggcaagggca agcaagggga caaacagggt ggcttccggg cgccgggcgg catgccgatg      1140
     atcgccggcg tcttcctgtt cggggtgctg actgcggcat tccacctgct caacatggca      1200
     ggtctgctgc ccgtctacac cggctga                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page