(data stored in ACNUC7421 zone)

EMBL: CP000462.PE117

CP000462.PE117       Location/Qualifiers
FT   CDS_pept        140006..140512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0126"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37508"
FT                   /db_xref="GOA:A0KEJ8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEJ8"
FT                   /protein_id="ABK37508.1"
FT                   /translation="MLIIFSGLPGSGKSTIARALAQRLGAVYLRIDTIEQAIRDAERTA
FT                   EEMGPAGYFVAYGLARENLKLGSTVITDSVNPIQLTRDAYHDIARSVGVPCLDVEVVCS
FT                   NSKLHRERVENRTVDIEGLALPDWQAVIDRDYQPWNSERLVLDSATLSVTQSVEKIVAA
FT                   LGKPL"
     atgctgatca tcttcagtgg tttgccgggg agcggaaaaa gcaccatagc acgggccctg        60
     gcccagcggt tgggcgccgt ctatctgcgc atcgatacca tagagcaggc cattcgtgat       120
     gctgaacgga cggctgaaga gatggggcct gccggttatt tcgtcgccta tgggctggcc       180
     agagaaaact tgaaactcgg ctcgaccgtc atcacggatt ccgttaaccc catccagctc       240
     acccgggatg cttaccacga catcgcccgc tcggtcgggg tgccctgtct cgatgtcgag       300
     gtggtctgct ccaactctaa gttgcaccgc gagcgggtag agaaccggac ggtggatatc       360
     gaggggctgg cattgccgga ttggcaggcg gtgatcgacc gcgactatca accctggaac       420
     agtgagcgtc tggtactgga tagcgccacc ctgtcggtca cccagagtgt ggaaaagatt       480
     gtcgctgcgt tgggaaagcc gttgtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page