(data stored in ACNUC7421 zone)

EMBL: CP000462.PE127

CP000462.PE127       Location/Qualifiers
FT   CDS_pept        complement(150754..152169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0136"
FT                   /product="signal transduction histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38358"
FT                   /db_xref="GOA:A0KEK8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK8"
FT                   /protein_id="ABK38358.1"
FT                   /translation="MPRSLLSRMLLLLLLAILLSQTILTGIWMQQIQKRELEGMLSTTR
FT                   NLALSAASTVNFFKSLPLQYRHIALDQLRNMGGSRFFVSLNEEEIHISAIPDSERKTLV
FT                   LKEVQGVLTRKLSDAMAIKVDFSRPEELHVFNNDTLLADLPSSWARYTLSLEPINPPVL
FT                   VTQIEIEPGEWLYLAALLPAPYMTLDDTVMPSNQVRFIALMTVFLCFFTFLLVRWQTRP
FT                   LRRLAKAAVNLGKDIDQPSLKEEGASEIVAATRAFNIMQHRIRRYIDDRERLFSSISHD
FT                   LKTPITRLRLRVELLDDEQQIAKFNKDLDELELMVKGALQTVKDTDIHENIEQLDIDAM
FT                   LEQMAEAMNLHDERLTIEGHCKQPYRGKPLALKRCIGNLVDNGIKYGQRVRIIIMDDEE
FT                   MLILFIMDEGPGLPEDQFERIFEPYYRLSTDLAGTGLGLGIARNIAHAHGGDLVLENRP
FT                   QGGLQATLSLPRQ"
     gtgccccgtt ccctgctgtc gcggatgctg ctgctgttgc tgctggcgat cctgctctcc        60
     cagaccatcc tcaccggcat ctggatgcag cagatccaga agcgggagct ggagggcatg       120
     ctcagcacca cccgcaatct ggcgctgtct gccgcctcca ccgtcaactt cttcaaatcc       180
     ttgccgctgc agtatcgcca catcgcgctg gaccagttgc gcaacatggg cggcagccgc       240
     ttcttcgtgt cgctgaacga ggaggagatc cacatcagcg ccatccccga cagcgagcgc       300
     aagacgctgg tgctcaaaga ggtgcagggg gtgctgaccc gcaagctctc cgacgccatg       360
     gcgatcaagg tggatttctc gcggcccgaa gagctgcacg tcttcaacaa cgacaccctg       420
     ctggcggatc taccctcctc ctgggcccgc tacaccctgt cgctggagcc gatcaacccg       480
     ccggtgctgg tgacccagat cgagatagag ccgggcgagt ggctctatct ggcggccctg       540
     ctgccggccc cctacatgac gctcgacgac accgtcatgc ccagcaacca ggtgcgcttc       600
     atcgccctga tgacggtgtt cctctgcttc ttcaccttcc tgctggtgcg ctggcagacc       660
     cggccgctgc gccggctggc caaggcggcc gtcaacctcg gcaaggacat cgaccagccc       720
     tcgctgaaag aggagggggc ctccgaaatc gtggcggcca cccgcgcctt caacatcatg       780
     cagcaccgca tccgccgcta tatcgacgat agagagcggc tgttcagctc gatttcccac       840
     gacctcaaga cccccatcac ccggctgcgg ctgcgggtcg agctgctcga cgacgaacag       900
     cagatcgcca agttcaacaa ggacctggac gagctggagc tgatggtgaa gggagcgctg       960
     cagacggtga aagacaccga catccacgag aacatcgagc agctcgacat cgacgccatg      1020
     ctggagcaga tggcggaggc catgaacctg cacgacgagc ggctgaccat cgaaggccac      1080
     tgcaagcagc cctaccgcgg caagccgctg gccctcaagc gctgcatcgg caacctggtg      1140
     gacaacggca tcaagtacgg ccaacgggtg cgcatcatca tcatggacga cgaggagatg      1200
     ctgatcctgt tcatcatgga cgaggggcct ggcctgccgg aggatcagtt cgaacgcatc      1260
     ttcgagccct actaccggct cagcacggat ctggccggca ccggcctggg tctgggcatt      1320
     gcccgcaaca tagcccacgc ccacggcggc gatctggtgc tggaaaatcg tccgcagggc      1380
     ggcctgcagg ccaccctctc cctaccaagg cagtaa                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page