(data stored in ACNUC7421 zone)

EMBL: CP000462.PE128

CP000462.PE128       Location/Qualifiers
FT   CDS_pept        complement(152251..152985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0137"
FT                   /product="GltR"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38417"
FT                   /db_xref="GOA:A0KEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEK9"
FT                   /protein_id="ABK38417.1"
FT                   /translation="MHIHMSTSKQLLIVDDDQEIRELLNEYLTRAGFEVLTAAEGNEMR
FT                   KLLAQHNPDLIILDIMMPGDDGFTLCQQIRRDSQVPIIMLTAASDEADRVIGLELGADD
FT                   YITKPFSPRELQARIKALLRRAEFRQPEKEKEPSRRLRFAEWTLDTLSHQRTHEDGSLL
FT                   DLSGSDALLLGMFLQQPGVVLDRDTISDATRGRESLPMERGIDVQISRLRQKLGDNGKS
FT                   PRIIKTIRGSGYMLIAEVHEIP"
     atgcacatac atatgtcaac gagcaaacaa ctgctgatcg tcgacgacga ccaagagatc        60
     cgcgagctgc tcaacgaata cctgaccagg gccggcttcg aggtattgac cgcagcggag       120
     ggcaacgaga tgcgcaagct gctcgcccag cacaacccgg acctcatcat tctcgatatc       180
     atgatgccgg gtgacgacgg ctttaccctc tgccagcaga tccgtcgcga ctcccaggtg       240
     cccatcatca tgctgaccgc cgcctccgat gaagcggacc gggtgatcgg cctcgagctc       300
     ggtgccgatg actacatcac caagccgttc agcccgcgcg aactgcaggc ccgcatcaag       360
     gcgctgctgc gccgcgccga attccgccag ccggagaaag agaaagagcc gagccgccgg       420
     ctgcgcttcg ccgagtggac tctggatacc ctgagccacc agcggaccca cgaggacggc       480
     agcctgctgg atctctccgg cagcgatgcc ctgctgctcg gcatgttcct gcaacagccc       540
     ggcgtggtgc tggaccggga taccatctcg gatgccaccc gcggtcgcga aagcctgccg       600
     atggagcgcg gcatcgacgt gcagatcagc cgcttgcgcc agaagctggg tgacaacggc       660
     aagagcccgc gcatcatcaa gaccattcgc ggcagtggct acatgctgat tgccgaggtg       720
     cacgagatcc catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page