(data stored in ACNUC7421 zone)

EMBL: CP000462.PE131

CP000462.PE131       Location/Qualifiers
FT   CDS_pept        complement(156833..158770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0140"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /EC_number="6.2.1.16"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR01217"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36572"
FT                   /db_xref="GOA:A0KEL2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL2"
FT                   /protein_id="ABK36572.1"
FT                   /translation="MHNLCLWQPDQERIQQSNLQHFMAEVNRFHGLQLHSYAQLYQWSV
FT                   EKTTRFWPLVWQHCGVKGELGNIVAENRQEMQRTRWFPDSRLNFAENLLRRQDDTPAII
FT                   SRIEGSPSQTLSWRELADQVARLAQWLRGQGIGRGDVVAAYLPNIPQTVVAMLATTSLG
FT                   AIWTSTSPDFGEASVVERFGQTRPRVLFAVDGYHYNGKAIDIQDKVAGVVGQIDSIEQT
FT                   VIIPLLGHPLQLGHDWRQILASQPDASLQFEPMAFNDPLYILYSSGTTGKPKCIVHGIG
FT                   GTLLQHLKEHQLHCDIKPGERIFYFTTCGWMMWNWLVSALASGATLVLYDGSPFYPDGN
FT                   VLWDLARDEEVALFGTSAKYLDALHKQGYAPIKTHQLPQLRLICSTGSVLSPEGFDYVY
FT                   QQIKRDVQLSSISGGTDICSCFVIGNPISPVYRGESQGRGLGLAVQVFNEAGQPVQGEK
FT                   GELVCTKPFPAQPIGFWGDASGDKYHAAYFERFDNIWCHGDWIELTPTGGILFYGRSDA
FT                   TLNPGGVRIGTSEIYRYVEQLEEVEESIVIGQQWQQDERVVLFVKLKPGLMLDEALRER
FT                   IRQQVRLHCTARHVPARILQVDAIPRTKSGKIVELAVREVVHNRPVNNTHALADPEVLS
FT                   QYRDRPELAS"
     atgcacaacc tttgcctgtg gcaaccggat caggagcgga ttcagcaatc caacctccag        60
     cacttcatgg ccgaggtcaa ccgcttccac ggcctgcagc tgcacagcta cgcccagctc       120
     taccagtggt cggtggagaa gacaacccgt ttctggccgc tggtgtggca gcactgcggc       180
     gtcaagggcg agctcggtaa catagtggcg gagaaccgcc aggagatgca gcgcacccgc       240
     tggttccccg acagccggct caacttcgcc gaaaacctgt tgcgccgcca ggacgacacg       300
     ccggccatca tctcccgcat cgagggtagc cccagccaga ccttgagctg gcgcgagctg       360
     gcggatcagg tcgccagact ggcccagtgg ctgcgtggcc agggcatcgg ccggggcgac       420
     gtagtggcag cctacctgcc caatatcccg caaaccgtgg tggccatgct ggcaaccacc       480
     agcctgggag cgatctggac ctccaccagc cccgatttcg gcgaagccag cgtggtggag       540
     cgcttcggcc agacccggcc gcgggtgctg tttgcggtgg atggctatca ctacaacggc       600
     aaggccatcg acattcagga caaagtggca ggggtcgtcg gccagatcga cagcatagag       660
     cagacagtca tcatccccct gctgggccat cccctgcagc tgggccacga ctggcgccag       720
     atcctggcca gccagccgga tgccagcctg cagttcgagc ccatggcctt caatgacccg       780
     ctctacatcc tctattcgtc cggcaccacc ggcaagccca agtgcatcgt gcacggcatc       840
     ggcggcaccc tgctgcaaca tctgaaagag catcagctgc actgcgacat caagccgggg       900
     gagcgcatct tctacttcac cacctgcggc tggatgatgt ggaactggct ggtgagcgcg       960
     ctcgcctccg gcgccaccct ggtgctctac gacggctccc ccttctaccc ggacggcaac      1020
     gtgttgtggg atctcgcccg cgacgaagag gtcgccctgt tcggcacctc ggccaaatac      1080
     ctggatgcgc tgcacaagca gggctatgcc cccatcaaga cccaccagct gccacagttg      1140
     cggcttatct gcagcaccgg ctccgtgctg tcgccggagg ggttcgacta cgtctatcag      1200
     cagatcaagc gggatgtgca gctcagctcc atttccggcg gcaccgacat ctgctcctgc      1260
     ttcgtcatcg gcaaccccat cagccccgtc taccgcggcg agagccaggg acgcggcctc      1320
     ggcctcgcgg tacaggtgtt caacgaagcg ggccagccgg tgcaggggga aaagggtgag      1380
     ctggtctgta ccaagccctt cccggcccag cccatcggtt tctgggggga cgccagcggc      1440
     gacaagtacc acgccgccta tttcgaacgg ttcgacaaca tctggtgcca tggcgactgg      1500
     atcgagctga ccccgaccgg cggcatcctg ttctacggtc gctccgacgc cactctcaac      1560
     ccggggggcg tgcgcatcgg caccagcgag atctaccgct atgtcgagca gctggaggaa      1620
     gtagaagaga gcatcgtcat cggccagcag tggcaacagg acgagcgggt ggtgctgttc      1680
     gtcaagctca agcccggcct catgctggac gaagcgctgc gcgagcgcat ccgccagcag      1740
     gtgcgcctgc actgcaccgc ccgtcacgtg ccagcccgca tcctgcaggt ggacgccatt      1800
     ccgcgcacca agtccggcaa gatagtggag ctggcggtgc gggaagtggt gcacaaccgg      1860
     cccgtcaaca acacccacgc cctcgccgat cccgaggtgc tgagccagta tcgcgaccgg      1920
     cccgaactgg ccagctga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page