(data stored in ACNUC7421 zone)

EMBL: CP000462.PE136

CP000462.PE136       Location/Qualifiers
FT   CDS_pept        complement(168638..171214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0149"
FT                   /product="acyl-CoA synthetase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36403"
FT                   /db_xref="GOA:A0KEL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL7"
FT                   /protein_id="ABK36403.1"
FT                   /translation="MKPSGLDRLFKPQSIAVIGASTDPQKAGHVVIRHLLAGQFKGPIL
FT                   PVSPHSTAIAGVLAYGDIDSLPLAPDLAIVCTRRERVLTLIEALGKRGAGAAIILAADF
FT                   TAPEREQLQQLSQQYGIRLLGPNSMGMLLPGQGINASFSPIAAKPGQVAFLSQSAAVST
FT                   TILDWAKQHELGFSAFISLGDHCDINFGQLLDQLSRDSVTRAILLYMDKLQDARHFLSA
FT                   ARAASRNKPILVLKSGRHEPDNGLDNVYDAAIRRAGMLRVRDTHELFAAVETLSHSLTL
FT                   KGERLAIISNGRGLANMAIDKLLERGGKLAMPPRDIGSDADINDYQQALDDLLQGDEAD
FT                   AILLIHAPSLTARGAALARSLIDYVKQHPRARRFNILTNWAGEYSAQEGRRLFSEAGFP
FT                   TYRTPESAVAAFMHMVEYRRNQKQLMETPASLQGDRLNLELCQQLIRQALERKQLTLDT
FT                   HLAHPILQAAGLSTLPTWIVSDAIEATLTAEQIGYPVAVKLRSPDILHKSAVHGVMLNL
FT                   RTSAEVAQAADAILDRVRQHDPSARIEGLLVQRMARRSGGLELRIRLQQDPVFGPVILL
FT                   GESGAEPQEMMAALPPLNQALARYQIIGALKSRKIREQASPERLDIDALGQVLCQLSEL
FT                   LLAFPEIQQLDLHPLQACGAEMVVLDASLTLQPAEEGRCRLAIRPYPTELEEGAWLKDQ
FT                   SHVLLRPIRPEDEPAHKQFVLKVSDEDRYKRFFADVGELGHEELARMTQIDYDREMAFV
FT                   AVGQDGPFDQQILGVVRAISNPDLSDAEFAILVRSDLKGLGLGKLMMEKIVRYARERGI
FT                   GQLSGMTMPSNRGMINLAKRLGFKIDIQLEDGVVNMELPCASQGQA"
     atgaaaccaa gcggcctgga tcggctcttc aaaccccagt caatcgccgt catcggtgcc        60
     tcgaccgacc cgcagaaggc gggtcacgtg gtgataagac acctgctcgc cggccagttc       120
     aagggcccca tcctgccagt cagcccgcac agcacggcca ttgccggcgt gctggcctat       180
     ggcgatatcg acagcctgcc gctggccccg gatctcgcca tcgtctgtac ccggcgggaa       240
     cgggtgctga ccctcatcga agcgcttggt aaacggggag cgggcgccgc catcatactg       300
     gcggcagact tcactgcgcc ggagcgggag cagctgcagc agctcagcca gcaatacggc       360
     atccgcctgc tcggccccaa cagcatgggg atgctgctgc cgggtcaggg catcaatgcc       420
     agtttctcgc cgattgccgc caagcccggt caggttgcct ttctctccca gtcggccgcc       480
     gtcagcacca ccatcctgga ttgggccaag cagcatgaac tcggcttctc ggccttcatc       540
     tcccttggcg atcactgcga catcaacttc ggccagctgc tggatcagct ctctcgcgac       600
     agcgtgaccc gcgccatcct gctctacatg gacaagctgc aggacgcccg ccattttctc       660
     tcggctgccc gcgctgcctc ccgcaacaag cccattctgg tgctcaagag cggccgccat       720
     gagccggaca acgggctcga caacgtctat gacgccgcca ttcgtcgtgc cggcatgctg       780
     cgggtgcggg atacccacga actgtttgcc gccgtcgaga ccctgagtca ctccctgact       840
     ctcaagggag agcggctcgc catcatttcc aatggccgtg gcttggccaa catggcgatc       900
     gacaagttgc tggagcgggg cggcaagctg gcgatgccgc ctcgcgacat cggcagcgat       960
     gccgacatca atgactatca gcaggcgctc gacgacctgc tgcaagggga cgaggctgac      1020
     gccatcctgc tcatccatgc cccttcgctc accgcccgtg gcgccgccct ggcgcgcagc      1080
     ctgatcgact acgtcaaaca gcaccccagg gccagacgct tcaatatcct gaccaactgg      1140
     gcgggagaat attcggccca ggaggggcgt cgtctgttca gcgaggcagg cttccccacc      1200
     taccgcaccc cggagagcgc agtcgccgcc ttcatgcaca tggtggaata ccggcgcaac      1260
     cagaagcagc tgatggagac ccccgcctcc ctgcagggtg acaggctcaa cctagagctg      1320
     tgccagcagt tgatccgaca ggcgctggaa cgcaaacagc tcaccctcga cacacatctg      1380
     gcacacccca ttctgcaggc tgctgggctc tccaccctgc cgacctggat cgtctccgat      1440
     gccatcgagg ccaccctgac cgcggagcag atcggctatc cagtcgcagt caagctgcgc      1500
     tcaccagaca tccttcacaa gtcggcggta cacggcgtca tgctcaacct gcgtacctcg      1560
     gccgaagtcg cccaggctgc ggatgccatt ctggatcggg tcaggcagca cgatcccagc      1620
     gcccgtatcg aaggcctgct ggtgcagcgc atggcgcgcc gcagcggggg gctggagctg      1680
     cggatccggc tgcaacaaga ccccgtattc ggccccgtca tcctgctcgg cgagtcaggg      1740
     gccgagccac aggagatgat ggcggccttg ccgccgctga accaggcgct ggcacgctac      1800
     cagatcatcg gggcgctcaa gagccgcaag atccgcgagc aggccagccc ggagcgactc      1860
     gacatcgatg ccctcggcca ggtgctgtgc caattgtcgg agttgctgct cgccttcccc      1920
     gagatccagc agctggatct gcatccactg caggcctgcg gcgccgaaat ggtggtactg      1980
     gatgccagcc tgactctgca acctgctgaa gaaggccgct gcagactggc catccgcccc      2040
     tatcccaccg aactggaaga gggggcctgg ctcaaggatc agagccatgt gctgctgcgc      2100
     ccgatccggc cggaagatga accggctcac aagcagtttg tgctcaaggt atcggatgaa      2160
     gacaggtaca agcgcttctt tgccgacgtg ggggagctgg gacatgaaga gctggcccgc      2220
     atgacccaga tcgattacga ccgggagatg gcgtttgtcg ccgtgggaca ggatggtccg      2280
     ttcgaccagc agatcctggg ggtagtacgc gccatttcca acccggacct gtctgatgca      2340
     gagtttgcca tcctggtgcg ctccgacctg aaagggctgg ggcttggcaa gctgatgatg      2400
     gagaagattg ttcgctatgc cagagaacgc ggcattggcc agctgtcggg catgaccatg      2460
     cccagcaacc gcggcatgat caacctggcc aaacggcttg gcttcaagat cgatatccag      2520
     ctggaagatg gggtggtcaa catggagctg ccctgcgcca gtcaagggca ggcataa         2577
//

If you have problems or comments...

PBIL Back to PBIL home page