(data stored in ACNUC7421 zone)

EMBL: CP000462.PE138

CP000462.PE138       Location/Qualifiers
FT   CDS_pept        171648..172520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38330"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEL9"
FT                   /protein_id="ABK38330.1"
FT                   /translation="MIRIWLCCVMLLAGSVPAAEVPIRAWNLLLDHPNPAVAALLRLSL
FT                   DLTVPEYGPYRLIASPPMEQGRAVKELQSGELVQIGVFAPDEERERTLLAIHVPLAKGL
FT                   LGWRVCLIRQGDEGRFANIRSLTDWQQAGLRIGQHRSWPDTRLLKENGLNVVVGSLYDA
FT                   LFNMLRKQRFDCFLRSVIEIEEELKQHPELAIEPHLVFRYPLALLFFVSPKYPELAKRI
FT                   ELGLQRARQSGDYERVFEAGFGSTIRRLQLDRRVMLELSNPDLPAGSRAMMQDPSLIYA
FT                   PALSAVSAQ"
     atgatcagga tctggttgtg ttgcgtcatg ttgttggccg gcagcgtacc ggcggcagaa        60
     gtgcccatca gggcctggaa cctgctgctg gaccatccca atcccgccgt ggctgctctg       120
     ctgcgactct cgctcgatct gaccgtaccc gaatacggtc cctatcggct gattgccagc       180
     ccgccgatgg agcagggacg ggcggtcaag gagttgcaaa gcggcgagct ggtgcagatc       240
     ggggtgtttg ctcccgacga ggagcgcgaa cgtaccctgc tggccatcca tgttccgctg       300
     gcaaaagggt tgctgggctg gcgggtgtgc ctcattcggc aaggggacga ggggcggttc       360
     gccaacatac gatcgctgac cgactggcaa caggccgggc ttcgcatcgg ccagcacaga       420
     tcctggcctg atacccgtct gctcaaggag aacggtctca acgtggtggt tggcagcctc       480
     tacgacgccc tgttcaacat gctgcgcaag cagcgcttcg actgcttcct gcgctcggtc       540
     atcgagatcg aggaggagct caagcagcac cctgagctgg ccatcgagcc acacctggtg       600
     tttcgctatc cgctggcgct gctgttcttt gtctcgccca agtacccgga actggccaag       660
     cgcatcgagc tcggcctgca gcgagcccgt cagtccggtg actatgagcg ggtattcgag       720
     gcgggttttg gcagcaccat ccggcggctg cagctggatc ggcgggtgat gctggagctg       780
     agcaatccgg atctgccggc cggcagccgg gccatgatgc aggatccttc gctcatctat       840
     gctccggcgc tgtccgccgt gtcagcgcag tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page