(data stored in ACNUC7421 zone)

EMBL: CP000462.PE143

CP000462.PE143       Location/Qualifiers
FT   CDS_pept        complement(177635..178471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0156"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="identified by match to protein family HMM PF00924;
FT                   match to protein family HMM PF05552"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37732"
FT                   /db_xref="GOA:A0KEM4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM4"
FT                   /protein_id="ABK37732.1"
FT                   /translation="MEPEIITEAQTWLVNNQGLLIEYAVNIAAALITLLVGYIAANLIS
FT                   SAVVKVMQARKLDTTVTHFVGSILKYAILVFVVIAALGRVGVQTASFVAIIGAAGLAIG
FT                   LALQGSLSNFAAGFLLIIFRPIKAGEFIEVAGTNGVVQSVQLFTTTLTSGDNKMVVVPN
FT                   SAILNGTIVNYSRMDTRRVDMTFGIGYGSDLRKAKQILERLVSEEPRILKEPAATIAVA
FT                   ALADSSVNIVVRPWVKTGDYWGVWFDFHEKVKLTFDAEGIEIPFPQMVMHMQKPQA"
     atggaacccg aaatcatcac cgaagcgcag acctggctgg tcaacaacca gggcctgctg        60
     atcgagtatg ccgtcaacat cgcggccgcc ctgatcaccc tgctggtcgg ctatatcgcc       120
     gccaacctca tcagcagcgc cgtggtcaag gtgatgcagg cccgcaagct ggacaccact       180
     gtcacccact tcgtcggcag catcctcaag tacgccatcc tggtgttcgt ggtgatcgcc       240
     gcgctgggcc gggtcggggt gcagaccgcc tccttcgtcg ccattatcgg tgccgccggt       300
     ctggccatcg gtctggcgct gcagggctcg ctctccaact ttgccgccgg cttcctgctc       360
     atcatcttcc gccccatcaa ggcaggtgag ttcatcgagg tggcaggcac caatggcgtg       420
     gtgcaatccg ttcagctgtt caccactacc ctcacctccg gtgacaacaa gatggtggtg       480
     gtgcccaact ccgccatcct caacggcacc atcgtcaact actcgcgcat ggatacccgc       540
     cgggtcgaca tgaccttcgg catcggctat ggctccgatc tgcgcaaggc caagcagatc       600
     ctggagcggc tggtcagcga agagccgcgc atcctcaagg agccggccgc caccatcgcc       660
     gtcgccgcgc tggccgactc ctcggtcaat atagtggtgc gcccctgggt caagaccggc       720
     gactactggg gagtctggtt cgacttccac gagaaggtga agctcacctt cgatgccgaa       780
     ggcatcgaga tccccttccc gcagatggtc atgcacatgc aaaagccaca ggcctga          837
//

If you have problems or comments...

PBIL Back to PBIL home page