(data stored in ACNUC7421 zone)

EMBL: CP000462.PE160

CP000462.PE160       Location/Qualifiers
FT   CDS_pept        complement(191843..192286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0173"
FT                   /product="ascorbate-specific phosphotransferase enzyme IIA
FT                   component"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39332"
FT                   /db_xref="GOA:A0KEP1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP1"
FT                   /protein_id="ABK39332.1"
FT                   /translation="MLTQLLTEEVISIEAGARDWRHAIELATAPLLANGTIEPSYVAAL
FT                   YRSHEELGPYYVLGPGLAMPHARPEDGVNRLGLALTVLKEGVNFGSEGNDPVRLLVTLA
FT                   ASDSNSHVETIAQLAELFMNEEDVAAIMAATSKDDILRILARY"
     atgctgaccc aattgctgac cgaggaggtc atttccatcg aagcgggtgc ccgcgactgg        60
     cgtcacgcca tcgagctggc caccgccccc ctgctggcca acggcaccat cgaaccctcc       120
     tatgtggcgg cgctctatcg ctcccacgaa gagctcggcc cctactacgt gctgggcccg       180
     ggcctggcca tgccccacgc ccgcccggaa gacggcgtca accggctggg actggcgctg       240
     accgtgctga aggagggggt caatttcggc tccgagggca acgacccggt ccggctgctg       300
     gtcaccctgg ccgccagcga cagcaactcc cacgtggaga ccatcgccca gctggccgag       360
     ctgttcatga atgaagaaga cgtggcggcc atcatggcgg ccaccagcaa agacgacatc       420
     ttgcgcatcc tggcgcgtta ttga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page