(data stored in ACNUC7421 zone)

EMBL: CP000462.PE164

CP000462.PE164       Location/Qualifiers
FT   CDS_pept        194898..195239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36971"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP5"
FT                   /protein_id="ABK36971.1"
FT                   /translation="MIMRLSVIVFAVLLGGCASHSDDPCEKVWSEVGEADGKLGFTAER
FT                   VEFHQAQCGEKVDAELWKQGHQKGLAWYCRPEHLYLAGRSGGEYRGVCPNDVQARRLFE
FT                   QGRQGWTDQ"
     atgattatgc gactctcggt gatagtgttt gccgttctgc tcgggggctg cgcctcccat        60
     tcggacgatc cgtgcgagaa ggtgtggagc gaggtggggg aggccgatgg caagctgggc       120
     tttaccgccg agcgggtcga gtttcatcag gcccagtgcg gtgagaaggt ggatgccgag       180
     ctgtggaaac aggggcatca gaagggactg gcctggtatt gccggccgga gcacctctat       240
     ctggcgggcc gttccggtgg cgagtatcgc ggggtttgcc ccaatgacgt ccaggcgcgc       300
     cggctgttcg agcagggccg ccagggctgg accgatcaat ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page