(data stored in ACNUC7421 zone)

EMBL: CP000462.PE167

CP000462.PE167       Location/Qualifiers
FT   CDS_pept        196109..196645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0180"
FT                   /product="chorismate--pyruvate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37637"
FT                   /db_xref="GOA:A0KEP8"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEP8"
FT                   /protein_id="ABK37637.1"
FT                   /translation="MKSELTVPLARLVPWQTPAQCEPPEALLPWLLEADSMTRRLRRHN
FT                   RHFSVQLFGNRSVALDADEQQLVVAEQPMGLCREVILHGDHGPAVLGWTLFAEAALQES
FT                   GLRELGEQPLGERIFGDEPARRDHLQLACFEIASNPWCPAGTVWGRRSRLFLGQWPLLV
FT                   HELFLPSLSCNKELE"
     gtgaagtccg agttgactgt tccccttgcc cggctcgtgc cctggcagac gcccgcgcag        60
     tgcgagccgc ccgaggcctt gctgccctgg ttgctggagg ccgattccat gacccggcgc       120
     ctgcgccgcc acaatcgcca cttctcggta caactgtttg gcaatcgcag cgtcgccctc       180
     gatgccgacg agcagcagct ggtggtcgcc gagcagccca tggggctgtg ccgcgaggtg       240
     atcctgcacg gcgatcatgg gccagccgtg ctgggctgga ccctgtttgc cgaagccgcg       300
     ctgcaagaga gcggtctgcg cgagctgggt gagcaaccgc tgggtgaacg tatctttggt       360
     gacgagcctg cccggcgcga tcacctgcaa ctggcctgtt tcgagattgc gagcaatccc       420
     tggtgcccgg ccggcaccgt ctggggacgt cgttcccgtc tgtttctggg gcaatggcca       480
     ctgctggtcc atgaactctt cttgccctct ctgtcatgca acaaggagct ggagtga          537
//

If you have problems or comments...

PBIL Back to PBIL home page