(data stored in ACNUC7421 zone)

EMBL: CP000462.PE172

CP000462.PE172       Location/Qualifiers
FT   CDS_pept        complement(201552..201671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38218"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ3"
FT                   /protein_id="ABK38218.1"
FT                   /translation="MDARSLANFRQKMTQGPVMPARTRPKQQPHHKVGLHKKQ"
     gtggatgccc gttcgctggc caacttccgt cagaagatga cgcaagggcc ggtgatgccg        60
     gcccgaaccc gcccaaaaca acagccccac cataaggtgg ggctgcacaa gaagcagtga       120
//

If you have problems or comments...

PBIL Back to PBIL home page