(data stored in ACNUC7421 zone)

EMBL: CP000462.PE174

CP000462.PE174       Location/Qualifiers
FT   CDS_pept        202386..203804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0187"
FT                   /product="DNA-damage-inducible protein F"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37282"
FT                   /db_xref="GOA:A0KEQ5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ5"
FT                   /protein_id="ABK37282.1"
FT                   /translation="MTHDEQRTPSDMLTPVWWRDGRRHRAVFALALPMVFSNVTTPLLG
FT                   LVDTWVIGHLGQAWFLGGVSVGATLINLLFWLLGFLRMSTTGLTAQAHGASSPAGQLDT
FT                   LARALGLAVGLGVTLLLLLLPLIPTLIALSGGSAEVQHYAAEYVSVRVWSAPAALCNLV
FT                   IMGWLLGMQDARSPMLLLIFTNLVNMGLDAWFVLGLGWQVKGVAAASLLADYSALGLGL
FT                   WLVSRHLRRLAASAWQGAWQRWRQWPALLRLLALNRDIFIRSLCLQLCFAFMTLQGARL
FT                   GDVAVAANAVLLNFLMLISYGLDGFAYAVEAMVGRAIGRRDRQGLREAIVLNLGWALLI
FT                   ALTFSLLFAVGGSRLIAHITDLPAVIAAANAQLPWLIAMPLLAVWCFLLDGVFIGATRA
FT                   REMRNSMLVAALCGFFPVWWLCQGWGVAALWAAMAALMAGRGLTLGWLCWQLERDGRLL
FT                   HSAHGVGEAQQASS"
     atgacgcatg atgagcaacg gactccctcc gacatgctga cccccgtttg gtggcgggac        60
     gggcggcgcc accgcgccgt gtttgccctg gccctgccca tggtgttttc caatgtcacc       120
     actccgctgc tggggctggt ggatacctgg gtgatcggtc atctcggtca ggcctggttc       180
     ctcggcggcg tgtcggtcgg cgccaccctc atcaacctgc tgttctggct gctcggcttt       240
     ttgcggatgt ccaccaccgg cctgaccgcc caggctcatg gtgccagcag cccggccggc       300
     cagctcgaca ccctggcccg tgcgctgggg ctcgccgtcg ggctgggagt gacgttgctg       360
     ctgctgttac tgccgttgat ccccactctc atcgcgctca gcggtggttc cgccgaggtg       420
     cagcactatg ccgccgagta cgtttcggtg cgggtctgga gcgccccggc ggcgctctgc       480
     aacctggtga tcatgggttg gctgctgggc atgcaggatg cgcgcagccc catgctgctg       540
     ctgatcttca ccaatctggt caacatgggg ctcgatgcct ggttcgtgct ggggctgggc       600
     tggcaggtga aaggggtcgc cgctgcctcg ctgctggcgg actacagcgc gctcgggttg       660
     gggctctggc tggtgagccg tcacctgcgc cggctggccg cgtcggcgtg gcagggagcc       720
     tggcagcgct ggcgtcagtg gcccgcgctg ctgcgactgc tggccctgaa ccgggacatc       780
     ttcatccgct ccctctgcct gcaactctgt ttcgccttca tgaccctgca gggggcccgg       840
     ctgggggatg tggcggtggc ggccaatgcg gtgctgctca acttcctgat gctgatctcc       900
     tacgggctgg atggcttcgc ctacgcagtg gaggccatgg tgggccgcgc catcgggcgg       960
     cgggatcggc aggggttgcg ggaggccatc gtgctcaatc tcggctgggc gctgctgatc      1020
     gccctgacgt tcagcctgct gtttgcggtg ggcggcagcc ggctgatcgc gcacatcacc      1080
     gatctgccgg cggttatcgc cgccgccaac gcacagctgc cgtggctcat cgccatgccg      1140
     ctgctggcgg tctggtgctt cctgctggac ggggtcttca tcggggcgac ccgagccagg      1200
     gagatgcgca acagcatgct ggtggcggca ctgtgcggct tcttcccggt ctggtggctc      1260
     tgtcagggct ggggtgtggc ggccttgtgg gccgcgatgg cggccttgat ggcggggcgg      1320
     gggctgacgc tgggctggct ctgctggcag ctggagcgcg atggccggct gctgcactca      1380
     gcccacgggg tgggagaggc gcagcaggcc tcctcctga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page