(data stored in ACNUC7421 zone)

EMBL: CP000462.PE175

CP000462.PE175       Location/Qualifiers
FT   CDS_pept        complement(203833..204339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0188"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36903"
FT                   /db_xref="GOA:A0KEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEQ6"
FT                   /protein_id="ABK36903.1"
FT                   /translation="MLAPFSPHQDAVMLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIE
FT                   PLGFEWDDKRVKRAGLDYHEFAEVKRWPNFEAFLEAVAPTRVFACTTKGRTAHSAVQFA
FT                   AGDALLFGPESRGLPIEIIESLPFEQRLRIPMLPQSRSMNLANAVAVFVYESWRQLGYA
FT                   GSLQE"
     atgctggcgc ccttttcgcc ccatcaggac gccgtcatgc tcgacatcgt gctctaccaa        60
     ccggaaattc cgcccaacac cggcaacatc atccgcctct gcgccaacac cggctatcga       120
     ctgcacctga tagagccgct gggattcgag tgggatgaca agcgagtgaa gcgggcgggg       180
     ctcgactacc acgagtttgc cgaggtgaag cgctggccga acttcgaggc ttttctggag       240
     gcggtggcac cgacgcgggt attcgcctgt accaccaagg ggcgcaccgc ccattcggca       300
     gtgcagtttg ccgcaggcga tgccctgctg ttcgggcccg agagccgcgg cctgcccatc       360
     gaaatcatcg agagcctgcc gttcgagcag cggctgcgca tccccatgct gccccagagc       420
     cgcagcatga acctcgccaa tgcggtggcg gtattcgtct acgaaagctg gcgccagctg       480
     ggctacgccg gctcgctgca ggaatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page