(data stored in ACNUC7421 zone)

EMBL: CP000462.PE180

CP000462.PE180       Location/Qualifiers
FT   CDS_pept        208227..209507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39745"
FT                   /db_xref="GOA:A0KER1"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER1"
FT                   /protein_id="ABK39745.1"
FT                   /translation="MAKRWSGYLILGMWLLNLLHLYLGFSPWPAAIAAWGASLLTWPWL
FT                   VGAARRQALALYGAALALLIFSCWRGASLTAGDWLLPNINMLTMFAAVSTLNLATSGLL
FT                   TGTTSWQGRKGLWSTMASLNLLGAVINLSVLFIIGDRLERNGTLERRQVLVLSRIFCAA
FT                   AFWSPFFVAMAVALTYAPGLQLSRILPFGVVATLLAMGLTAWQVERLGVAEFAGYPLRL
FT                   QTLGLPVALALLVLLIKQIWPDLGILAVIALVAPLLAFAFMPSAGRGPALKRQVVERFP
FT                   AIGGQLVLFLGAGLLAAGINSALSVFELGGGHGLSFFHHFGWLESSLTLLLILLVAIVG
FT                   VHPLISISGLAPLLWPLSPDPSLLGMCFLLGWGLATGTSPLSGSNLALASRYNLSAGAI
FT                   LRGNLLYGLLMYGVACLLLGAYIALHA"
     atggccaagc gctggtcggg ttatctgatc ctggggatgt ggctgctcaa cctgctgcat        60
     ctctatctgg gattctcccc ctggccggcg gccatcgcgg cctggggggc ctcgctgctc       120
     acctggccct ggctggtggg cgcggcgcgg cgccaggcgc tggccctgta cggggcagcg       180
     ctggcactgc tgatcttctc ctgctggcgg ggggcgagcc tcaccgccgg tgactggttg       240
     ctgcccaaca tcaacatgct caccatgttt gcggcggtga gcaccctcaa tctcgccacc       300
     tcgggtctct tgaccggcac cacctcatgg caaggacgca aggggctgtg gagcaccatg       360
     gccagcctca acctgctggg ggccgtcatc aacctctcgg tgctgttcat catcggtgat       420
     cggctggagc gtaacggcac ccttgagcgg cgtcaggtgc tggtgctgag ccggatcttc       480
     tgcgcggcgg ccttctggtc ccccttcttc gtcgccatgg cggtggcgct cacctatgcg       540
     cccggcctgc agctgtcgcg catcctgccg ttcggggtgg tggcgaccct gctggcgatg       600
     gggctgaccg cctggcaggt ggaacggctg ggggtggcgg agtttgccgg ctatccgctg       660
     cggctgcaga ctctgggcct gccggtggca ctggccctgc tggtgctgct gatcaagcag       720
     atctggccgg atctcggcat cctggcggtg atcgccctgg tggcaccgct gctggccttt       780
     gccttcatgc cgagcgcggg gcgtggcccg gccctcaagc ggcaggtggt ggaacgtttc       840
     cccgccatcg gcggccaact ggtgctgttt ctgggggctg gcctgctggc cgccggcatc       900
     aacagtgcgc tgtcggtgtt cgagctgggt ggcggccacg gcttgtcctt ctttcatcat       960
     ttcggctggc tggagtcttc gctcaccctg ttgctgatcc tgctggtggc catcgtcggg      1020
     gtgcacccgc tcatcagcat ctccggactg gcgccgctgt tgtggccgct ctcgccggat      1080
     cccagcctgc tcggcatgtg cttcctgctg ggctgggggc tggccaccgg caccagcccg      1140
     ctctccggct ccaacctggc gctggcctcc cgctacaacc tgagtgccgg ggcgattctg      1200
     cgcggcaacc tgctctacgg cctgctgatg tacggggtcg cctgtctgct gctgggggcc      1260
     tatatcgccc tgcacgcctg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page